Recombinant Human Frizzled 7 protein (ab191958)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLE VHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPCRSLCERARQGCE ALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYPTA PYL
    • Molecular weight
      43 kDa including tags
    • Amino acids
      33 to 185
    • Additional sequence information
      Fused with Fc fragment of Human IgG1 at the C-terminus (AAH15915).

Specifications

Our Abpromise guarantee covers the use of ab191958 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    > 92 % SDS-PAGE.

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Upon reconsitution add a carrier protein (0.1% BSA). Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 5% Trehalose, 0.75% Glycine, 0.61% Tris

    Lyophilized from 0.22 µm filtered solution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names
    • Frizzled 7, seven transmembrane spanning receptor
    • frizzled class receptor 7
    • Frizzled drosophila homolog of 7
    • Frizzled family receptor 7
    • Frizzled homolog 7
    • Frizzled-7
    • Frizzled7
    • Fz 7
    • Fz-7
    • Fz7
    • FZD 7
    • FZD7
    • FZD7_HUMAN
    • FzE 3
    • FzE3
    • hFz 7
    • hFz7
    • Homolog of Drosophila Frizzled 7
    • OTTHUMP00000163742
    see all
  • Function
    Receptor for Wnt proteins. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues.
  • Tissue specificity
    High expression in adult skeletal muscle and fetal kidney, followed by fetal lung, adult heart, brain, and placenta. Specifically expressed in squamous cell esophageal carcinomas.
  • Sequence similarities
    Belongs to the G-protein coupled receptor Fz/Smo family.
    Contains 1 FZ (frizzled) domain.
  • Domain
    Lys-Thr-X-X-X-Trp motif is involved in the activation of the Wnt/beta-catenin signaling pathway.
    The FZ domain is involved in binding with Wnt ligands.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of DTT-reduced ab191958 stained overnight with Coomassie Blue. DTT-reduced protein migrates as 50-55 kDa due to glycosylation.

References

ab191958 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191958.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up