Recombinant Human Frizzled 7 protein (ab191958)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Tags: Fc tag C-Terminus
- Suitable for: SDS-PAGE
Description
-
Product name
Recombinant Human Frizzled 7 protein
See all Frizzled 7 proteins and peptides -
Purity
> 95 % SDS-PAGE. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
QPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLE VHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPCRSLCERARQGCE ALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYPTA PYL -
Predicted molecular weight
43 kDa including tags -
Amino acids
33 to 185 -
Tags
Fc tag C-Terminus -
Additional sequence information
Fused with Fc fragment of Human IgG1 at the C-terminus (AAH15915). The protein migrates as 50-60 kDa under reducing (R) condition (SDS-PAGE) due to glycosylation.
-
Specifications
Our Abpromise guarantee covers the use of ab191958 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at 4°C prior to reconstitution. Upon reconsitution add a carrier protein (0.1% BSA). Store at -80°C. Avoid freeze / thaw cycle.
pH: 7.4
Constituents: 0.75% Glycine, 0.61% Tris, Sodium chloride, L-Arginine
Lyophilized from 0.22 µm filtered solution. Normally trehalose is added as protectant before lyophilization. -
ReconstitutionReconstitute with sterile deionized water to a concentration of 100 µg/ml.
General Info
-
Alternative names
- Frizzled 7, seven transmembrane spanning receptor
- frizzled class receptor 7
- Frizzled drosophila homolog of 7
see all -
Function
Receptor for Wnt proteins. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues. -
Tissue specificity
High expression in adult skeletal muscle and fetal kidney, followed by fetal lung, adult heart, brain, and placenta. Specifically expressed in squamous cell esophageal carcinomas. -
Sequence similarities
Belongs to the G-protein coupled receptor Fz/Smo family.
Contains 1 FZ (frizzled) domain. -
Domain
Lys-Thr-X-X-X-Trp motif is involved in the activation of the Wnt/beta-catenin signaling pathway.
The FZ domain is involved in binding with Wnt ligands. -
Cellular localization
Membrane. - Information by UniProt
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab191958 has not yet been referenced specifically in any publications.