Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSCCSCPDKDTVPDNHRNKFKVINVDDDGNELGSGIMELTDTELILYTR KRDSVKWHYLCLRRYGYDSNLFSFESGRRCQTGQGIFAFKCARAEELFNM LQEIMQNNSINVVEEPVVERNNHQTELEVPRTPRTPTTPGFAAQNLPNGY PRYPSFGDASSHPSSRHPSVGSARLPSVGEESTHPLLVAEEQVHTYVNTT GVQEERKNRTSVHVPLEARVSNAESSTPKEEPSSIEDRDPQILLEPEGVK FVLGPTPVQKQLMEKEKLEQLGRDQVSGSGANNTEWDTGYDSDERRDAPS VNKLVYENINGLSIPSASGVRRGRLTSTSTSDTQNINNSAQ
    • Molecular weight
      63 kDa including tags
    • Amino acids
      1 to 341

Specifications

Our Abpromise guarantee covers the use of ab112397 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

    Other

  • Form
    Liquid
  • Additional notes
    Best to use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione
    Note: Glutathione is reduced.

General Info

  • Alternative names
    • FGFR signaling adaptor SNT
    • FGFR signalling adaptor
    • FGFR substrate 2
    • FGFR-signaling adaptor SNT
    • Fibroblast growth factor receptor substrate 2
    • FRS 2
    • FRS2
    • FRS2_HUMAN
    • FRS2A
    • FRS2alpha
    • SNT
    • SNT 1
    • SNT-1
    • SNT1
    • Suc 1 Associated Neurotrophic Factor Target
    • Suc1 associated neurotrophic factor target 1
    • Suc1-associated neurotrophic factor target 1
    see all
  • Function
    Adapter protein that links FGR and NGF receptors to downstream signaling pathways. Involved in the activation of MAP kinases. Modulates signaling via SHC1 by competing for a common binding site on NTRK1.
  • Tissue specificity
    Highly expressed in heart, brain, spleen, lung, liver, skeletal muscle, kidney and testis.
  • Sequence similarities
    Contains 1 IRS-type PTB domain.
  • Post-translational
    modifications
    Phosphorylated on tyrosine residues upon stimulation by NGF.
    Ubiquitinated when tyrosine phosphorylated and in a complex with GRB2. The unphosphorylated form is not subject to ubiquitination.
  • Cellular localization
    Endomembrane system. Cytoplasmic, membrane-bound.
  • Information by UniProt

Recombinant Human FRS2 protein images

  • 12.5% SDS-PAGE analysis of ab112397. Stained with Coomassie Blue

References for Recombinant Human FRS2 protein (ab112397)

ab112397 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112397.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up