Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSCCSCPDKDTVPDNHRNKFKVINVDDDGNELGSGIMELTDTELILYTR KRDSVKWHYLCLRRYGYDSNLFSFESGRRCQTGQGIFAFKCARAEELFNM LQEIMQNNSINVVEEPVVERNNHQTELEVPRTPRTPTTPGFAAQNLPNGY PRYPSFGDASSHPSSRHPSVGSARLPSVGEESTHPLLVAEEQVHTYVNTT GVQEERKNRTSVHVPLEARVSNAESSTPKEEPSSIEDRDPQILLEPEGVK FVLGPTPVQKQLMEKEKLEQLGRDQVSGSGANNTEWDTGYDSDERRDAPS VNKLVYENINGLSIPSASGVRRGRLTSTSTSDTQNINNSAQ
    • Molecular weight
      63 kDa including tags
    • Amino acids
      1 to 341

Specifications

Our Abpromise guarantee covers the use of ab112397 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

    Other

  • Form
    Liquid
  • Additional notes
    Best to use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione
    Note: Glutathione is reduced.

General Info

  • Alternative names
    • FGFR signaling adaptor SNT
    • FGFR signalling adaptor
    • FGFR substrate 2
    • FGFR-signaling adaptor SNT
    • Fibroblast growth factor receptor substrate 2
    • FRS 2
    • FRS2
    • FRS2_HUMAN
    • FRS2A
    • FRS2alpha
    • SNT
    • SNT 1
    • SNT-1
    • SNT1
    • Suc 1 Associated Neurotrophic Factor Target
    • Suc1 associated neurotrophic factor target 1
    • Suc1-associated neurotrophic factor target 1
    see all
  • Function
    Adapter protein that links FGR and NGF receptors to downstream signaling pathways. Involved in the activation of MAP kinases. Modulates signaling via SHC1 by competing for a common binding site on NTRK1.
  • Tissue specificity
    Highly expressed in heart, brain, spleen, lung, liver, skeletal muscle, kidney and testis.
  • Sequence similarities
    Contains 1 IRS-type PTB domain.
  • Post-translational
    modifications
    Phosphorylated on tyrosine residues upon stimulation by NGF.
    Ubiquitinated when tyrosine phosphorylated and in a complex with GRB2. The unphosphorylated form is not subject to ubiquitination.
  • Cellular localization
    Endomembrane system. Cytoplasmic, membrane-bound.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab112397. Stained with Coomassie Blue

References

ab112397 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab112397.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up