Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDSQKEALQRIISTLANKNDEIQNFIDTLHHTLKGVQENSSNILSELDEE FDSLYSILDEVKESMINCIKQEQARKSQELQSQISQCNNALENSEELLEF ATRSLDIKEPEEFSKVHKNCINTLNKGSCIFKKAFLFFFSFGFLY
    • Amino acids
      1 to 145
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164448 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CCDC10
    • Coiled coil domain containing 10
    • Coiled-coil domain-containing protein 10
    • CSDUFD1
    • Cystatin and DUF19 domain containing 1
    • Fibronectin type III and SPRY domain containing 1 like
    • FSD1 C terminal like
    • FSD1 N terminal like
    • FSD1 N-terminal-like protein
    • FSD1-like protein
    • FSD1CL
    • Fsd1l
    • FSD1L_HUMAN
    • FSD1NL
    • MIR1
    see all
  • Sequence similarities
    Contains 1 B30.2/SPRY domain.
    Contains 1 COS domain.
    Contains 1 fibronectin type-III domain.
  • Information by UniProt

Images

  • ab164448 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164448 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164448.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up