Overview

  • Product name
    Recombinant Human FTSJ3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGKKGKVGKSRRDKFYHLAKETGYRSRSAFKLIQLNRRFQFLQKARALLD LCAAPGGWLQVAAKFMPVSSLIVGVDLVPIKPLPNVVTLQEDITTERCRQ ALRKELKTWKVDVVLNDGAPNVGASWVHDAYSQAHLTLMALRLACDFLAR GGSFITKVFRSRDYQPLLWIFQQLFRRVQATKPQASRHESAEIFVVCQGF LAPDKVDSKFFDPKFAFKEVEVQAKTVTELVTKKKPKAEGYAEGDLTLYH RTSVTDFLRAANPVDFLSKASEIMVDDEELAQHPATTEDIRVCCQDIRVL GRKELRSLLNWRTKLRRYVAKKLKEQAKALDISLSSGEEDEGDEEDSTAG TTKQPSKEEEEEEEEEQLNQTLAEMKAQEVAELKRKKKKLLREQRKQRER VELKMDLPGVSIADEGETGMFSLCTIRGHQLLEEVTQGDMSAADTFLSDL PRDDIYVSDVEDDGDDTSLDSDLDPEELAGVRGHQGLRDQKRMRLTEVQD DKEEEEEENPLLVPLEEKAVLQEEQANLWFSKGSFAGIEDDADEALEISQ AQLLFENRRKGRQQQQKQQLPQTPPSCLKTEIMSPLYQDEAPKGTEASSG TEAATGLEGEEKDGISDSDSSTSSEEEESWEPLRGKKRSRGPKSDDDGFE IVPIEDPAKHRILDPEGLALGAVIASSKKAKRDLIDNSFNRYTFNEDEGE LPEWFVQEEKQHRIRQLPVGKKEVEHYRKRWREINARPIKKVAEAKARKK RRMLKRLEQTRKKAEAVVNTVDISEREKVAQLRSLYKKAGLGKEKRHVTY VVAKKGVGRKVRRPAGVRGHFKVVDSRMKKDQRAQQRKEQKKKHKRK
    • Amino acids
      1 to 847
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165132 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2''-O-ribose RNA methyltransferase SPB1 homolog
    • EPCS3
    • FLJ20062
    • FtsJ homolog 3 (E. coli)
    • FTSJ3
    • pre-rRNA processing protein FTSJ3
    • Protein ftsJ homolog 3
    • Putative rRNA methyltransferase 3
    • SPB1
    • SPB1_HUMAN
    see all
  • Function
    Probable methyltransferase involved in the processing of the 34S pre-rRNA to 18S rRNA and in 40S ribosomal subunit formation.
  • Sequence similarities
    Belongs to the methyltransferase superfamily. RlmE family. SPB1 subfamily.
  • Cellular localization
    Nucleus > nucleolus.
  • Information by UniProt

Images

  • ab165132 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165132 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165132.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up