Recombinant Human FTSJD2 protein (ab161524)

Overview

  • Product name
    Recombinant Human FTSJD2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MKRRTDPECTAPIKKQKKRVAELALSLSSTSDDEPPSSVSHGAKASTTSL SGSDSETEGKQHSSDSFDDAFKADSLVEGTSSRYSMYNSVSQKLMAKMGF REGEGLGKYSQGRKDIVEASSQKGRRGLGLTLRGFDQELNVDWRDEPEPS ACEQVSWFPECTTEIPDTQEMSDWMVVGKRKMIIEDETEFCGEELLHSVL QCKSVFDVLDGEEMRRARTRANPYEMIRGVFFLNRAAMKMANMDFVFDRM FTNPRDSYGKPLVKDREAELLYFADVCAGPGGFSEYVLWRKKWHAKGFGM TLKGPNDFKLEDFYSASSELFEPYYGEGGIDGDGDITRPENISAFRNFVL DNTDRKGVHFLMADGGFSVEGQENLQEILSKQLLLCQFLMALSIVRTGGH FICKTFDLFTPFSVGLVYLLYCCFERVCLFKPITSRPANSERYVVCKGLK VGIDDVRDYLFAVNIKLNQLRNTDSDVNLVVPLEVIKGDHEFTDYMIRSN ESHCSLQIKALAKIHAFVQDTTLSEPRQAEIRKECLRLWGIPDQARVAPS SSDPKSKFFELIQGTEIDIFSYKPTLLTSKTLEKIRPVFDYRCMVSGSEQ KFLIGLGKSQIYTWDGRQSDRWIKLDLKTELPRDTLLSVEIVHELKGEGK AQRKISAIHILDVLVLNGTDVREQHFNQRIQLAEKFVKAVSKPSRPDMNP IRVKEVYRLEEMEKIFVRLEMKIIKGSSGTPKLSYTGRDDRHFVPMGLYI VRTVNEPWTMGFSKSFKKKFFYNKKTKDSTFDLPADSIAPFHICYYGRLF WEWGDGIRVHDSQKPQDQDKLSKEDVLSFIQMHRA
    • Amino acids
      1 to 835
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161524 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cap methyltransferase 1
    • Cap-specific mRNA (nucleoside-2''-O-)-methyltransferase 1
    • Cap1 2''O-ribose methyltransferase 1
    • CMTR1
    • CMTR1_HUMAN
    • FLJ22156
    • FtsJ methyltransferase domain containing 2
    • FtsJ methyltransferase domain-containing protein 2
    • FTSJD 2
    • hMTr1
    • Interferon-stimulated gene 95 kDa protein
    • ISG95
    • KIAA0082
    • MTr1
    • OTTHUMP00000016324
    • Uncharacterized protein KIAA0082
    see all
  • Function
    S-adenosyl-L-methionine-dependent methyltransferase that mediates mRNA cap1 2'-O-ribose methylation to the 5'-cap structure of mRNAs. Methylates the ribose of the first nucleotide of a m(7)GpppG-capped mRNA and small nuclear RNA (snRNA) to produce m(7)GpppRm (cap1). Displays a preference for cap0 transcripts. Cap1 modification is linked to higher levels of translation. May be involved in the interferon response pathway.
  • Sequence similarities
    Contains 1 G-patch domain.
    Contains 1 RrmJ-type SAM-dependent 2'-O-MTase domain.
    Contains 1 WW domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab161524 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161524 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161524.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up