Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP04066
    • SpeciesHuman
    • SequenceEAIYASKPWRVQWEKNTTSVWYTSKGSAVYAIFLHWPENGVLNLESPITT STTKITMLGIQGDLKWSTDPDKGLFISLPQLPPSAVPAEFAWTIKLTGVK
    • Molecular weight37 kDa including tags
    • Amino acids367 to 466

Specifications

Our Abpromise guarantee covers the use of ab114799 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Alpha L fucosidase I
    • Alpha L fucoside fucohydrolase
    • Alpha-L-fucosidase 1
    • Alpha-L-fucosidase I
    • Alpha-L-fucoside fucohydrolase 1
    • FUCA
    • FUCA1
    • FUCO_HUMAN
    • fucosidase, alpha-L, tissue
    • fucosidase, alpha-L- 1, tissue
    • Tissue alpha L fucosidase
    • Tissue alpha-L-fucosidase
    see all
  • FunctionAlpha-L-fucosidase is responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins.
  • Involvement in diseaseDefects in FUCA1 are the cause of fucosidosis (FUCA1D) [MIM:230000]. FUCA1D is an autosomal recessive lysosomal storage disease characterized by accumulation of fucose-containing glycolipids and glycoproteins in various tissues. Clinical signs include facial dysmorphism, dysostosis multiplex, moderate hepatomegaly, severe intellectual deficit, deafness, and according to age, angiokeratomas.
  • Sequence similaritiesBelongs to the glycosyl hydrolase 29 family.
  • Cellular localizationLysosome.
  • Information by UniProt

Recombinant Human FUCA1 protein images

  • ab114799 on 12.5% SDS-PAGE Stained with Coomassie Blue.

References for Recombinant Human FUCA1 protein (ab114799)

ab114799 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114799.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"