Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ9BTY2
    • SpeciesHuman
    • SequenceMRPQELPRLAFPLLLLLLLLLPPPPCPAHSATRFDPTWESLDARQLPAWF DQAKFGIFIHWGVFSVPSFGSEWFWWYWQKEKIPKYVEFMKDNYPPSFKY EDFGPLFTAKFFNANQWADIFQASGAKYIVLTSKHHEGFTLWGSEYSWNW NAIDEGPKRDIVKELEVAIRNRTDLRFGLYYSLFEWFHPLFLEDESSSFH KRQFPVSKTLPELYELVNNYQPEVLWSDGDGGAPDQYWNSTGFLAWLYNE SPVRGTVVTNDRWGAGSICKHGGFYTCSDRYNPGHLLPHKWENCMTIDKL SWGYRREAGISDYLTIEELVKQLVETVSCGGNLLMNIGPTLDGTISVVFE ERLRQVGSWLKVNGEAIYETYTWRSQNDTVTPDVWYTSKPKEKLVYAIFL KWPTSGQLFLGHPKAILGATEVKLLGHGQPLNWISLEQNGIMVELPQLTI HQMPCKWGWALALTNVI
    • Molecular weight77 kDa including tags
    • Amino acids1 to 467

Specifications

Our Abpromise guarantee covers the use of ab117022 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • Alpha L fucosidase 2
    • Alpha L fucosidase fucohydrolase 2
    • Alpha-L-fucosidase 2
    • Alpha-L-fucoside fucohydrolase 2
    • dJ20N2.5
    • FUCA 2
    • FUCA2
    • FUCO2
    • FUCO2_HUMAN
    • Fucosidase alpha L 2 plasma
    • Fucosidase, alpha-L, plasma
    • MGC1314
    • Plasma alpha L fucosidase
    • Plasma alpha-L-fucosidase
    • RP1 20N2.5
    see all
  • FunctionAlpha-L-fucosidase is responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins.
  • Sequence similaritiesBelongs to the glycosyl hydrolase 29 family.
  • Cellular localizationSecreted.
  • Information by UniProt

Recombinant Human FUCA2 protein images

  • 12.5% SDS-PAGE showing ab117022 at approximately 77.44 kDa.
    Stained with Coomassie Blue.

References for Recombinant Human FUCA2 protein (ab117022)

ab117022 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab117022.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"