Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MRPQELPRLAFPLLLLLLLLLPPPPCPAHSATRFDPTWESLDARQLPAWF DQAKFGIFIHWGVFSVPSFGSEWFWWYWQKEKIPKYVEFMKDNYPPSFKY EDFGPLFTAKFFNANQWADIFQASGAKYIVLTSKHHEGFTLWGSEYSWNW NAIDEGPKRDIVKELEVAIRNRTDLRFGLYYSLFEWFHPLFLEDESSSFH KRQFPVSKTLPELYELVNNYQPEVLWSDGDGGAPDQYWNSTGFLAWLYNE SPVRGTVVTNDRWGAGSICKHGGFYTCSDRYNPGHLLPHKWENCMTIDKL SWGYRREAGISDYLTIEELVKQLVETVSCGGNLLMNIGPTLDGTISVVFE ERLRQVGSWLKVNGEAIYETYTWRSQNDTVTPDVWYTSKPKEKLVYAIFL KWPTSGQLFLGHPKAILGATEVKLLGHGQPLNWISLEQNGIMVELPQLTI HQMPCKWGWALALTNVI
    • Molecular weight
      77 kDa including tags
    • Amino acids
      1 to 467

Specifications

Our Abpromise guarantee covers the use of ab117022 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • Alpha L fucosidase 2
    • Alpha L fucosidase fucohydrolase 2
    • Alpha-L-fucosidase 2
    • Alpha-L-fucoside fucohydrolase 2
    • dJ20N2.5
    • FUCA 2
    • FUCA2
    • FUCO2
    • FUCO2_HUMAN
    • Fucosidase alpha L 2 plasma
    • Fucosidase, alpha-L, plasma
    • MGC1314
    • Plasma alpha L fucosidase
    • Plasma alpha-L-fucosidase
    • RP1 20N2.5
    see all
  • Function
    Alpha-L-fucosidase is responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins.
  • Sequence similarities
    Belongs to the glycosyl hydrolase 29 family.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab117022 at approximately 77.44 kDa.
    Stained with Coomassie Blue.

References

ab117022 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab117022.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up