Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KVFTNTWAVRIPGGPAVANSVARKHGFLNLGQIFGDYYHFWHRGVTKRSL SPHRPRHSRLQREPQVQWLEQQVAKRRTKRDVYQEPTDPKFPQQWYLSGV TQRDLNVKAAWAQGYTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVND QDPDPQPRYTQMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRML DGEVTDAVEARSLGLNPNHIHIYSASWGPEDDGKTVDGPARLAEEAFFRG VSQGRGGLGSIFVWASGNGGREHDSCNCDGYTNSIYTLSISSATQFGNVP WYSEACSSTLATTYSSGNQNEKQIVTTDLRQKCTESHTGTSASAPLAAGI IALTLEANKNLTWRDMQHLVVQTSKPAHLNANDWATNGVGRKVSHSYGYG LLDAGAMVALAQNWTTVAPQRKCIIDILTEPKDIGKRLEVRKTVTACLGE PNHITRLEHAQARLTLSYNRRGDLAIHLVSPMGTRSTLLAARPHDYSADG FNDWAFMTTHSWDEDPSGEWVLEIENTSEANNYGTLTKFTLVLYGTAPEG LPVPPESSGCKTLTSSQACVVCEEGFSLHQKSCVQHCPPGFAPQVLDTHY STENDVETIRASVCAPCHASCATCQGPALTDCLSCPSHASLDPVEQTCSR QSQSSRESPPQQQPPRLPPEVEAGQRLRAGLLPSHLPEVVAGLSCAFIVL VFVTVFLVLQLRSGFSFRGVKVYTMDRGLISYKGLPPEAWQEECPSDSEE DEGRGERTAFIKDQSAL
    • Amino acids
      28 to 794
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159045 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Dibasic processing enzyme
    • Dibasic-processing enzyme
    • FES upstream region
    • FUR
    • FURIN
    • Furin membrane associated receptor protein
    • FURIN_HUMAN
    • PACE
    • Paired basic amino acid residue cleaving enzyme
    • Paired basic amino acid residue-cleaving enzyme
    • PCSK3
    • Proprotein convertase subtilisin/kexin type 3
    • SPC1
    see all
  • Function
    Furin is likely to represent the ubiquitous endoprotease activity within constitutive secretory pathways and capable of cleavage at the RX(K/R)R consensus motif.
  • Tissue specificity
    Seems to be expressed ubiquitously.
  • Sequence similarities
    Belongs to the peptidase S8 family. Furin subfamily.
    Contains 1 homo B/P domain.
  • Domain
    Contains a cytoplasmic domain responsible for its TGN localization and recycling from the cell surface.
  • Post-translational
    modifications
    The inhibition peptide, which plays the role of an intramolecular chaperone, is autocatalytically removed in the endoplasmic reticulum (ER) and remains non-covalently bound to furin as a potent autoinhibitor. Following transport to the trans Golgi, a second cleavage within the inhibition propeptide results in propeptide dissociation and furin activation.
    Phosphorylation is required for TGN localization of the endoprotease. In vivo, exists as di-, mono- and non-phosphorylated forms.
  • Cellular localization
    Golgi apparatus > trans-Golgi network membrane. Cell membrane. Shuttles between the trans-Golgi network and the cell surface. Propeptide cleavage is a prerequisite for exit of furin molecules out of the endoplasmic reticulum (ER). A second cleavage within the propeptide occurs in the trans Golgi network (TGN), followed by the release of the propeptide and the activation of furin.
  • Information by UniProt

Images

  • ab159045 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159045 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159045.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up