Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      TSKALGPSQLRGMWTINAIGRLGNQMGEYATLYALAKMNGRPAFIPAQMH STLAPIFRITLPVLHSATASRIPWQNYHLNDWMEEEYRHFPGEYVRFTGY
    • Amino acids
      51 to 150
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158478 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2)FT 2
    • Alpha (1,2) fucosyltransferase
    • Alpha(1
    • Alpha(1,2)FT 2
    • Alpha(1,2)FT2
    • B12QTL1
    • Fucosyltransferase 2
    • fucosyltransferase 2 (secretor status included)
    • FUT2
    • FUT2_HUMAN
    • Galactoside 2-alpha-L-fucosyltransferase 2
    • GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 2
    • SE
    • SE2
    • SEC2
    • Secretor blood group alpha-2-fucosyltransferase
    • Secretor factor
    • Sej
    see all
  • Function
    Creates a soluble precursor oligosaccharide FuC-alpha ((1,2)Galbeta-) called the H antigen which is an essential substrate for the final step in the soluble A and B antigen synthesis pathway. H and Se enzymes fucosylate the same acceptor substrates but exhibit different Km values.
  • Tissue specificity
    Small intestine, colon and lung.
  • Pathway
    Protein modification; protein glycosylation.
  • Sequence similarities
    Belongs to the glycosyltransferase 11 family.
  • Cellular localization
    Golgi apparatus > Golgi stack membrane. Membrane-bound form in trans cisternae of Golgi.
  • Information by UniProt

Images

  • ab158478 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158478 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158478.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up