Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SEMVPGTADCHITADRKVYPQADTVIVHHWDIMSNPKSRLPPSPRPQGQR WIWFNLEPPPNCQHLEALD
    • Molecular weight
      33 kDa including tags
    • Amino acids
      82 to 150

Specifications

Our Abpromise guarantee covers the use of ab114431 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Alpha-(1,3/1,4)-fucosyltransferase
    • Blood group Lewis alpha-4-fucosyltransferase
    • CD174
    • FT3B
    • Fucosyltransferase 3
    • Fucosyltransferase 3 (galactoside 3(4)-L-fucosyltransferase, Lewis blood group)
    • Fucosyltransferase III
    • FucT III
    • FucT-III
    • FUT3
    • FUT3_HUMAN
    • Galactoside 3(4)-L-fucosyltransferase
    • LE
    • Les
    • Lewis FT
    see all
  • Function
    May catalyze alpha-1,3 and alpha-1,4 glycosidic linkages involved in the expression of Vim-2, Lewis A, Lewis B, sialyl Lewis X and Lewis X/SSEA-1 antigens. May be involved in blood group Lewis determination; Lewis-positive (Le(+)) individuals have an active enzyme while Lewis-negative (Le(-)) individuals have an inactive enzyme. Also acts on the corresponding 1,4-galactosyl derivative, forming 1,3-L-fucosyl links.
  • Tissue specificity
    Highly expressed in stomach, colon, small intestine, lung and kidney and to a lesser extent in salivary gland, bladder, uterus and liver.
  • Pathway
    Protein modification; protein glycosylation.
  • Sequence similarities
    Belongs to the glycosyltransferase 10 family.
  • Cellular localization
    Golgi apparatus > Golgi stack membrane. Membrane-bound form in trans cisternae of Golgi.
  • Information by UniProt

Images

  • ab114431 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab114431 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114431.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up