Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SEMVPGAADCNITADSSVYPQADAVIVHHWDIMYNPSANLPPPTRPQGQR WIWFSMESPSNCRHLEALDG
    • Amino acids
      95 to 164
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158479 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 3)-fucosyltransferase
    • Alpha (1 3) fucosyltransferase
    • Alpha-(1
    • FUC TV
    • FUC-TV
    • Fucosyltransferase 5
    • Fucosyltransferase 5 (alpha (1 3) fucosyltransferase)
    • Fucosyltransferase V
    • FucT V
    • FUT 5
    • FUT5
    • FUT5_HUMAN
    • Galactoside 3 L fucosyltransferase
    see all
  • Information by UniProt

Images

  • ab158479 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158479 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158479.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up