Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      YEAFVPADAFVHVDDFGSARELAAFLTGMNESRYQRFFAWRDRLRVRLFT DWRERFCAICDRYPHLPRSQVYEDLEGWFQA
    • Amino acids
      262 to 342
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158481 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 3)-fucosyltransferase
    • Alpha (1,3) fucosyltransferase
    • Alpha (1,3) fucosyltransferase 7
    • Alpha-(1
    • Fuc-TVII
    • Fucosyltransferase 7
    • Fucosyltransferase 7 (alpha (1,3) fucosyltransferase)
    • Fucosyltransferase VII
    • FucT VII
    • FucT-VII
    • FUT7
    • FUT7_HUMAN
    • Galactoside 3 L fucosyltransferase
    • Galactoside 3-L-fucosyltransferase
    • Selectin ligand synthase
    see all
  • Function
    May catalyze alpha-1,3 glycosidic linkages involved in the expression of sialyl Lewis X antigens.
  • Tissue specificity
    Leukocytic/myeloid lineage cells.
  • Pathway
    Protein modification; protein glycosylation.
  • Sequence similarities
    Belongs to the glycosyltransferase 10 family.
  • Cellular localization
    Golgi apparatus > Golgi stack membrane. Membrane-bound form in trans cisternae of Golgi.
  • Information by UniProt

Images

  • ab158481 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158481 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158481.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up