Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      EIMQTLHPDASANFHSLDDIYYFGGQNAHNQIAIYAHQPRTADEIPMEPG DIIGVAGNHWDGYSKGVNRKLGRTGLYPSYKVREKIETVKYPTYPEAEK
    • Molecular weight
      37 kDa including tags
    • Amino acids
      477 to 575

Specifications

Our Abpromise guarantee covers the use of ab114701 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 6-fucosyltransferase
    • Alpha (1,6) fucosyltransferase
    • Alpha-(1,6)-fucosyltransferase
    • Alpha1 6FucT
    • alpha1-6FucT
    • Fucosyltransferase 8
    • Fucosyltransferase 8 (alpha (1,6) fucosyltransferase)
    • FUT8
    • FUT8_HUMAN
    • GDP fucose glycoprotein fucosyltransferase
    • GDP L Fuc:N acetyl beta D glucosaminide alpha1,6 fucosyltransferase
    • GDP-fucose--glycoprotein fucosyltransferase
    • GDP-L-Fuc:N-acetyl-beta-D-glucosaminide alpha1
    • Glycoprotein 6 alpha L fucosyltransferase
    • Glycoprotein 6-alpha-L-fucosyltransferase
    • MGC26465
    see all
  • Function
    Catalyzes the addition of fucose in alpha 1-6 linkage to the first GlcNAc residue, next to the peptide chains in N-glycans.
  • Pathway
    Protein modification; protein glycosylation.
  • Sequence similarities
    Belongs to the glycosyltransferase 23 family.
    Contains 1 SH3 domain.
  • Cellular localization
    Golgi apparatus > Golgi stack membrane. Membrane-bound form in trans cisternae of Golgi.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab114701 at approximately 36.52 kDa stained with Coomassie Blue.

References

ab114701 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114701.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up