Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ9BYC5
    • SpeciesHuman
    • SequenceMRPWTGSWRWIMLILFAWGTLLFYIGGHLVRDNDHPDHSSRELSKILAKL ERLKQQNEDLRRMAESLRIPEGPIDQGPAIGRVRVLEEQLVKAKEQIENY KKQTRNGLGKDHEILRRRIENGAKELWFFLQSELKKLKNLEGNELQRHAD EFLLDLGHHERSIMTDLYYLSQTDGAGDWREKEAKDLTELVQRRITYLQN PKDCSKAKKLVCNINKGCGYGCQLHHVVYCFMIAYGTQRTLILESQNWRY ATGGWETVFRPVSETCTDRSGISTGHWSGEVKDKNVQVVELPIVDSLHPR PPYLPLAVPEDLADRLVRVHGDPAVWWVSQFVKYLIRPQPWLEKEIEEAT KKLGFKHPVIGVHVRRTDKVGTEAAFHPIEEYMVHVEEHFQLLARRMQVD KKRVYLATDDPSLLKEAKTKYPNYEFISDNSISWSAGLHNRYTENSLRGV ILDIHFLSQADFLVCTFSSQVCRVAYEIMQTLHPDASANFHSLDDIYYFG GQNAHNQIAIYAHQPRTADEIPMEPGDIIGVAGNHWDGYSKGVNRKLGRT GLYPSYKVREKIETVKYPTYPEAEK
    • Molecular weight89 kDa including tags
    • Amino acids1 to 575

Specifications

Our Abpromise guarantee covers the use of ab114702 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 6-fucosyltransferase
    • Alpha (1,6) fucosyltransferase
    • Alpha-(1,6)-fucosyltransferase
    • Alpha1 6FucT
    • alpha1-6FucT
    • Fucosyltransferase 8
    • Fucosyltransferase 8 (alpha (1,6) fucosyltransferase)
    • FUT8
    • FUT8_HUMAN
    • GDP fucose glycoprotein fucosyltransferase
    • GDP L Fuc:N acetyl beta D glucosaminide alpha1,6 fucosyltransferase
    • GDP-fucose--glycoprotein fucosyltransferase
    • GDP-L-Fuc:N-acetyl-beta-D-glucosaminide alpha1
    • Glycoprotein 6 alpha L fucosyltransferase
    • Glycoprotein 6-alpha-L-fucosyltransferase
    • MGC26465
    see all
  • FunctionCatalyzes the addition of fucose in alpha 1-6 linkage to the first GlcNAc residue, next to the peptide chains in N-glycans.
  • PathwayProtein modification; protein glycosylation.
  • Sequence similaritiesBelongs to the glycosyltransferase 23 family.
    Contains 1 SH3 domain.
  • Cellular localizationGolgi apparatus > Golgi stack membrane. Membrane-bound form in trans cisternae of Golgi.
  • Information by UniProt

Recombinant Human FUT8 protein images

  • 12.5% SDS-PAGE showing ab114702 at approximately 89.32 kDa stained with Coomassie Blue.

References for Recombinant Human FUT8 protein (ab114702)

ab114702 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114702.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"