Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMKPLALPGAHVVVTGGSSGIGKCIAIECYK QGAFITLVARNEDKLLQAKKEIEMHSINDKQVVLCISVDVSQDYNQVENV IKQAQEKLGPVDMLVNCAGMAVSGKFEDLEVSTFERLMSINYLGSVYPSR AVITTMKERRVGRIVFVSSQAGQLGLFGFTAYSASKFAIRGLAEALQMEV KPYNVYITVAYPPDTDTPGFAEENRTKPLETRLISETTSVCKPEQVAKQI VKDAIQGNFNSSLGSD
    • Molecular weight
      29 kDa including tags
    • Amino acids
      26 to 270
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab104822 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab104822 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, 0.1mM PMSF, pH 8.0

General Info

  • Alternative names
    • 3 dehydrosphinganine reductase
    • 3 ketodihydrosphingosine reductase
    • 3-dehydrosphinganine reductase
    • 3-ketodihydrosphingosine reductase
    • DHSR
    • FLJ36555
    • FLJ92680
    • Follicular lymphoma variant translocation 1
    • Follicular variant translocation protein 1
    • FVT 1
    • FVT-1
    • FVT1
    • KDS reductase
    • KDSR
    • KDSR_HUMAN
    • SDR35C1
    • Short chain dehydrogenase/reductase family 35C member 1
    see all
  • Function
    Catalyzes the reduction of 3-ketodihydrosphingosine (KDS) to dihydrosphingosine (DHS).
  • Tissue specificity
    Expressed in all tissues examined. Highest expression in placenta. High expression in lung, kidney, stomach and small intestine, low expression in heart, spleen and skeletal muscle. Weakly expressed in normal hematopoietic tissues. Higher expression in some T-cell malignancies and PHA-stimulated lymphocytes.
  • Pathway
    Lipid metabolism; sphingolipid metabolism.
  • Involvement in disease
    A chromosomal aberration involving KDSR is a cause of follicular lymphoma; also known as type II chronic lymphatic leukemia. Translocation t(2;18)(p11;q21) with a Ig J kappa chain region (PubMed:8417785).
  • Sequence similarities
    Belongs to the short-chain dehydrogenases/reductases (SDR) family.
  • Cellular localization
    Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab104822.

References

ab104822 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab104822.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up