Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ06136
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMKPLALPGAHVVVTGGSSGIGKCIAIECYK QGAFITLVARNEDKLLQAKKEIEMHSINDKQVVLCISVDVSQDYNQVENV IKQAQEKLGPVDMLVNCAGMAVSGKFEDLEVSTFERLMSINYLGSVYPSR AVITTMKERRVGRIVFVSSQAGQLGLFGFTAYSASKFAIRGLAEALQMEV KPYNVYITVAYPPDTDTPGFAEENRTKPLETRLISETTSVCKPEQVAKQI VKDAIQGNFNSSLGSD
    • Molecular weight29 kDa including tags
    • Amino acids26 to 270
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab104822 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab104822 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, 0.1mM PMSF, pH 8.0

General Info

  • Alternative names
    • 3 dehydrosphinganine reductase
    • 3 ketodihydrosphingosine reductase
    • 3-dehydrosphinganine reductase
    • 3-ketodihydrosphingosine reductase
    • DHSR
    • FLJ36555
    • FLJ92680
    • Follicular lymphoma variant translocation 1
    • Follicular variant translocation protein 1
    • FVT 1
    • FVT-1
    • FVT1
    • KDS reductase
    • KDSR
    • KDSR_HUMAN
    • SDR35C1
    • Short chain dehydrogenase/reductase family 35C member 1
    see all
  • FunctionCatalyzes the reduction of 3-ketodihydrosphingosine (KDS) to dihydrosphingosine (DHS).
  • Tissue specificityExpressed in all tissues examined. Highest expression in placenta. High expression in lung, kidney, stomach and small intestine, low expression in heart, spleen and skeletal muscle. Weakly expressed in normal hematopoietic tissues. Higher expression in some T-cell malignancies and PHA-stimulated lymphocytes.
  • PathwayLipid metabolism; sphingolipid metabolism.
  • Involvement in diseaseA chromosomal aberration involving KDSR is a cause of follicular lymphoma; also known as type II chronic lymphatic leukemia. Translocation t(2;18)(p11;q21) with a Ig J kappa chain region (PubMed:8417785).
  • Sequence similaritiesBelongs to the short-chain dehydrogenases/reductases (SDR) family.
  • Cellular localizationEndoplasmic reticulum membrane.
  • Information by UniProt

Recombinant Human FVT1 protein images

  • 15% SDS-PAGE analysis of 3µg ab104822.

References for Recombinant Human FVT1 protein (ab104822)

ab104822 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab104822.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"