Overview

  • Product name
    Recombinant Human FXYD3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      NDLEDKNSPFYYDWHSLQVGGLICAGVLCAMGIIIVMSAKCKCKFGQKSG HHPGETPPLITPGSAQS
    • Molecular weight
      33 kDa including tags
    • Amino acids
      21 to 87

Specifications

Our Abpromise guarantee covers the use of ab116879 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Chloride conductance inducer protein Mat 8
    • Chloride conductance inducer protein Mat-8
    • FXYD domain containing ion transport regulator 3
    • FXYD domain-containing ion transport regulator 3
    • Fxyd3
    • FXYD3_HUMAN
    • Mammary tumor 8 kDa protein
    • MAT-8
    • MAT8
    • MGC111076
    • Phospholemman like
    • Phospholemman-like
    • PLML
    see all
  • Function
    Induces a hyperpolarization-activated chloride current when expressed in Xenopus oocytes. May be a modulator capable of activating endogenous oocyte channels.
  • Tissue specificity
    Expressed in a subset of human breast tumors.
  • Sequence similarities
    Belongs to the FXYD family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Recombinant Human FXYD3 protein images

  • 12.5% SDS-PAGE showing ab116879 at approximately 33.48kDa stained with Coomassie Blue.

References for Recombinant Human FXYD3 protein (ab116879)

ab116879 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116879.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up