Overview

  • Product name
    Recombinant Human FYCO1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MNTKVTSDWYYARSPFLQPKLSSDIVGQLYELTEVQFDLASRGFDLDAAW PTFARRTLTTGSSAYLWKPPSRSSSMSSLVSSYLQTQEMVSNFDLNSPLN NEALEGFDEMRLELDQLEVREKQLQERMQQLDRENQELRAAVSQQGEQLQ TERERGRTAAEDNVRLTCLVAELQKQWEVTQATQNTVKELQTCLQALELG AAEKEEDYHTALRRLESMLQPLAQELEATRDSLDKKNQHLASFPGWLAMA LHVGD
    • Amino acids
      1 to 255
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164031 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CATC2
    • CTRCT18
    • DKFZp779K1152
    • FLJ13335
    • FYCO1
    • FYCO1_HUMAN
    • FYVE and coiled coil domain containing 1
    • FYVE and coiled coil domain containing protein 1
    • FYVE and coiled-coil domain-containing protein 1
    • MGC126517
    • MGC126519
    • RUFY3
    • RUN and FYVE domain containing 3
    • ZFYVE7
    • Zinc finger FYVE domain containing protein 7
    • Zinc finger FYVE domain-containing protein 7
    see all
  • Tissue specificity
    Expressed in heart and skeletal muscle.
  • Sequence similarities
    Contains 1 FYVE-type zinc finger.
    Contains 1 GOLD domain.
    Contains 1 RUN domain.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Information by UniProt

Images

  • ab164031 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164031 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164031.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up