Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      Theoretical Sequence: ATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCAT YKLCHPEELVLLGHSLGIPWAPLSS CPSQALQLAGCLSQLHSGLFLYQ GLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELG MAPALQPTQ GAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP

Specifications

Our Abpromise guarantee covers the use of ab83995 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    The ED50 of ab83995 is typically 0.01 - 0.03 ng/ml as measured in a cell proliferation assay using a murine myeloblastic M-NFS-60 cell line.
  • Applications

    SDS-PAGE

    Functional Studies

  • Purity
    > 95 % SDS-PAGE.

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C.

    Preservative: None
    Constituents: 10% Trehalose, 1% Human serum albumin

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.

General Info

  • Alternative names
    • C17orf33
    • Colony stimulating factor 3
    • Colony stimulating factor 3 (granulocyte)
    • CSF 3
    • CSF beta
    • CSF3
    • CSF3_HUMAN
    • CSF3OS
    • Csfg
    • Filgrastim
    • G-CSF
    • GCSA
    • GCSF
    • Granulocyte colony stimulating factor
    • Granulocyte colony-stimulating factor
    • Lenograstim
    • Macrophage granulocyte inducer 2
    • MGC45931
    • MGI 2
    • Pluripoietin
    see all
  • Function
    Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. This CSF induces granulocytes.
  • Sequence similarities
    Belongs to the IL-6 superfamily.
  • Post-translational
    modifications
    O-glycan consists of Gal-GalNAc disaccharide which can be modified with up to two sialic acid residues (done in recombinantly expressed G-CSF from CHO cells).
  • Cellular localization
    Secreted.
  • Information by UniProt

References

ab83995 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab83995.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up