Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      Theoretical Sequence: ATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCAT YKLCHPEELVLLGHSLGIPWAPLSS CPSQALQLAGCLSQLHSGLFLYQ GLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELG MAPALQPTQ GAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP

Specifications

Our Abpromise guarantee covers the use of ab83995 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    The ED50 of ab83995 is typically 0.01 - 0.03 ng/ml as measured in a cell proliferation assay using a murine myeloblastic M-NFS-60 cell line.
  • Applications

    SDS-PAGE

    Functional Studies

  • Purity
    > 95 % SDS-PAGE.

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C.

    Preservative: None
    Constituents: 10% Trehalose, 1% Human serum albumin

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.

General Info

  • Alternative names
    • C17orf33
    • Colony stimulating factor 3
    • Colony stimulating factor 3 (granulocyte)
    • CSF 3
    • CSF beta
    • CSF3
    • CSF3_HUMAN
    • CSF3OS
    • Csfg
    • Filgrastim
    • G-CSF
    • GCSA
    • GCSF
    • Granulocyte colony stimulating factor
    • Granulocyte colony-stimulating factor
    • Lenograstim
    • Macrophage granulocyte inducer 2
    • MGC45931
    • MGI 2
    • Pluripoietin
    see all
  • Function
    Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. This CSF induces granulocytes.
  • Sequence similarities
    Belongs to the IL-6 superfamily.
  • Post-translational
    modifications
    O-glycan consists of Gal-GalNAc disaccharide which can be modified with up to two sialic acid residues (done in recombinantly expressed G-CSF from CHO cells).
  • Cellular localization
    Secreted.
  • Information by UniProt

References for Recombinant human G-CSF protein (ab83995)

ab83995 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab83995.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up