Recombinant Human G gamma14 protein (ab158550)

Overview

  • Product name
    Recombinant Human G gamma14 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAQDLSEKDLLKMEVEQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDPFL KGIPEDKNPFKEKGGCLIS
    • Amino acids
      1 to 69
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158550 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • G GAMMA 8
    • G gamma 9
    • G GAMMA C
    • G gamma-C
    • G protein cone gamma 8 subunit
    • G-gamma-8
    • G-gamma-9
    • gamma T2 subunit
    • GBGT2_HUMAN
    • GNG8
    • GNG9
    • GNGT2
    • GNGT8
    • guanine nucleotide binding protein (G protein), gamma transducing
    • guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 2
    • Guanine nucleotide binding protein G
    • guanine nucleotide binding protein gamma 9
    • guanine nucleotide binding protein gamma transducing activity
    • Guanine nucleotide binding protein gamma transducing activity polypeptide 2
    • Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2
    • IG
    • Ogamma T2 subunit precursor
    • SG
    see all
  • Function
    Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.
  • Tissue specificity
    Retinal cones.
  • Sequence similarities
    Belongs to the G protein gamma family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab158550 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158550 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158550.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up