Recombinant Human G gamma3 protein (ab116918)

Overview

  • Product name
    Recombinant Human G gamma3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MKGETPVNSTMSIGQARKMVEQLKIEASLCRIKVSKAAADLVTYCDAHAC EDPLITPVPTSENPFREKKFFCALL
    • Molecular weight
      34 kDa including tags
    • Amino acids
      1 to 75

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116918 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • GBG3_HUMAN
    • GNG3
    • Guanine nucleotide-binding protein G(I)/G(S)/G(O) gamma-3 subunit
    • Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3
  • Function
    Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.
  • Sequence similarities
    Belongs to the G protein gamma family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Recombinant Human G gamma3 protein images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116918 at approximately 33.99 kDa.

References for Recombinant Human G gamma3 protein (ab116918)

ab116918 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116918.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up