Recombinant Human G gamma3 protein (ab116918)

Overview

  • Product name
    Recombinant Human G gamma3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MKGETPVNSTMSIGQARKMVEQLKIEASLCRIKVSKAAADLVTYCDAHAC EDPLITPVPTSENPFREKKFFCALL
    • Molecular weight
      34 kDa including tags
    • Amino acids
      1 to 75

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116918 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • GBG3_HUMAN
    • GNG3
    • Guanine nucleotide-binding protein G(I)/G(S)/G(O) gamma-3 subunit
    • Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3
  • Function
    Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.
  • Sequence similarities
    Belongs to the G protein gamma family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116918 at approximately 33.99 kDa.

References

ab116918 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116918.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up