Recombinant Human G protein alpha 16 (ab158537)

Overview

  • Product name
    Recombinant Human G protein alpha 16
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MARSLTWRCCPWCLTEDEKAAARVDQEINRILLEQKKQDRGELKLLLLGP GESGKSTFIKQMRIIHGAGYSEEERKGFRPLVYQNIFVSMRAMIEAMERL QIPFSRPESKHHASLVMSQDPYKVTTFEKRYAAAMQWLWRDAGIRACYER RREFHLLDSAVYYLSHLERITEEGYVPTAQDVLRSRMPTTGINEYCFSVQ KTNLRIVDVGGQKSERKKWIHCFENVIALIYLASLSEYDQCLEENNQENR MKESLALFGTILELPWFKSTSVILFLNKTDILEEKIPTSHLATYFPSFQG PKQDAEAAKRFILDMYTRMYTGCVDGPEGSKKGARSRRLFSHYTCATDTQ NIRKVFKDVRDSVLARYLDEINLL
    • Amino acids
      1 to 374
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158537 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • G alpha 15
    • G alpha 16
    • G alpha-15
    • G alpha-16
    • G-protein subunit alpha-15
    • G-protein subunit alpha-16
    • GNA 15
    • GNA 16
    • GNA15
    • GNA15_HUMAN
    • GNA16
    • Gq class
    • Guanine nucleotide binding protein alpha 15
    • Guanine nucleotide binding protein alpha 15 subunit
    • Guanine nucleotide-binding protein subunit alpha-15
    • Guanine nucleotide-binding protein subunit alpha-16
    see all
  • Function
    Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems.
  • Tissue specificity
    Specifically expressed in hematopoietic cells.
  • Sequence similarities
    Belongs to the G-alpha family. G(q) subfamily.
  • Information by UniProt

Images

  • ab158537 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158537 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158537.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up