Recombinant Human G protein alpha inhibitor 1 (ab113585)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMGCTLSAEDKAAVERSKMIDRNLREDG EKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNT IQSIIAIIRAMGRLKIDFGDSARADDARQLFVLAGAAEEGFMTAELAGVI KRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRT RVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVAL SDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEK IKKSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCAT DTKNVQFVFDAVTDVIIKNNLKDCGLF
    • Molecular weight
      43 kDa including tags
    • Amino acids
      1 to 354
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113585 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab113585 was purified using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names
    • Adenylate cyclase inhibiting G alpha protein
    • Adenylate cyclase inhibitory protein
    • Adenylate cyclase-inhibiting G alpha protein
    • G protein alpha inhibiting 1
    • G protein alpha inhibiting activity polypeptide 1
    • Gi
    • Gi inhibitory G protein
    • Gi1 protein alpha subunit
    • GNAI 1
    • GNAI1
    • GNAI1_HUMAN
    • Guanine nucleotide binding protein (G protein) alpha inhibiting activity polypeptide 1
    • Guanine nucleotide binding protein alpha inhibiting activity polypeptide 1
    • Guanine nucleotide binding protein G(i) alpha 1 subunit
    • Guanine nucleotide-binding protein G(i) subunit alpha-1
    • OTTHUMP00000161319
    • OTTHUMP00000208047
    see all
  • Function
    Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. The G(i) proteins are involved in hormonal regulation of adenylate cyclase: they inhibit the cyclase in response to beta-adrenergic stimuli. The inactive GDP-bound form prevents the association of RGS14 with centrosomes and is required for the translocation of RGS14 from the cytoplasm to the plasma membrane. May play a role in cell division.
  • Sequence similarities
    Belongs to the G-alpha family. G(i/o/t/z) subfamily.
  • Cellular localization
    Nucleus. Cytoplasm. Cell membrane. Cytoplasm > cytoskeleton > centrosome. Localized at the plasma membrane throughout mitosis. Colocalizes with RIC8A and RGS14 at the plasma membrane (By similarity). Localizes in the centrosomes of interphase and mitotic cells, but not in centrosomes during cytokinesis. Detected at the cleavage furrow or the midbody.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab113585.

References

ab113585 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab113585.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up