Recombinant Human G Protein alpha x+z (ab116998)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP19086
    • SpeciesHuman
    • SequenceMGCRQSSEEKEAARRSRRIDRHLRSESQRQRREIKLLLLGTSNSGKSTIV KQMKIIHSGGFNLEACKEYKPLIIYNAIDSLTRIIRALAALRIDFHNPDR AYDAVQLFALTGPAESKGEITPELLGVMRRLWADQGAQACFSRSSEYHLE DNAAYYLNDLERIAAADYIPTVEDILRSRDMTTGIVENKFTFKELTFKMV DVGGQRSERKKWIHCFEGVTAIIFCVELSGYDLKLYEDNQTSRMAESLRL FDSICNNNWFINTSLILFLNKKDLLAEKIRRIPLTICFPEYKGQNTYEEA AVYIQRQFEDLNRNKETKEIYSHFTCATDTSNIQFVFDAVTDVIIQNNLK YIGLC
    • Molecular weight67 kDa including tags
    • Amino acids1 to 355

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116998 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • G(x) alpha chain
    • GNAZ
    • GNAZ_HUMAN
    • Guanine nucleotide binding protein (G protein) alpha z polypeptide
    • Guanine nucleotide binding protein G(z) alpha subunit G(x) alpha chain
    • Guanine nucleotide binding protein G(z) subunit alpha
    • Guanine nucleotide-binding protein G(z) subunit alpha
    • Gz alpha
    • Gz-alpha
    • Human Gx alpha gene
    • Transducin alpha
    see all
  • FunctionGuanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems.
  • Sequence similaritiesBelongs to the G-alpha family. G(i/o/t/z) subfamily.
  • Cellular localizationMembrane.
  • Information by UniProt

Recombinant Human G Protein alpha x+z images

  • 12.5% SDS-PAGE showing ab116998 at approx. 67.16 kDa.
    Stained with Coomassie Blue.

References for Recombinant Human G Protein alpha x+z (ab116998)

ab116998 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116998.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"