Recombinant Human G-protein coupled receptor 30 (ab152434)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MDVTSQARGVGLEMYPGTAQPAAPNTTSPELNLSHPLLGTALANGTGELS EHQQYVIGLFLSCLYTIFLFPIGFVGNILILVVNISFREKMTIPDLYFIN LAVADLILVADSLIEVFNLHERYYDIAVLCTFMSLFLQVNMYSSVFFLTW MSFDRYIALARAMRCSLFRTKHHARLSCGLIWMASVSATLVPFTAVHLQH TDEACFCFADVREVQWLEVTLGFIVPFAIIGLCYSLIVRVLVRAHRHRGL RPRRQKALRMILAVVLVFFVCWLPENVFISVHLLQRTQPGAAPCKQSFRH AHPLTGHIVNLAAFSNSCLNPLIYSFLGETFRDKLRLYIEQKTNLPALNR FCHAALKAVIPDSTEQSDVRFSSAV
    • Molecular weight
      69 kDa including tags
    • Amino acids
      1 to 375

Specifications

Our Abpromise guarantee covers the use of ab152434 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CEPR
    • Chemoattractant receptor-like 2
    • Chemokine receptor-like 2
    • CMKRL2
    • Constitutively expressed peptide like receptor
    • DRY12
    • FEG 1
    • FEG-1
    • Flow-induced endothelial G protein-coupled receptor
    • Flow-induced endothelial G-protein coupled receptor 1
    • G protein-coupled receptor 30
    • G-protein coupled estrogen receptor 1
    • G-protein coupled receptor 30
    • GPCR-BR
    • Gper
    • GPER_HUMAN
    • GPER1
    • GPR30
    • IL8-related receptor DRY12
    • Lergu
    • LERGU2
    • leucine rich protein in GPR30 3'UTR
    • LYGPR
    • Lymphocyte-derived G-protein coupled receptor
    • Membrane estrogen receptor
    • mER
    • MGC99678
    see all
  • Function
    Receptor for estrogen.
  • Tissue specificity
    Ubiquitously expressed, but is most abundant in placenta. In brain regions, expressed as a 2.8 kb transcript in basal forebrain, frontal cortex, thalamus, hippocampus, caudate and putamen.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization
    Cell membrane. Endoplasmic reticulum membrane. Golgi apparatus membrane. Protein has been detected in the cell membrane, endoplasmic reticulum and Golgi apparatus. It is currently unclear whether this is a cell surface or intracellular receptor.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152434 stained with Coomassie Blue.

References

ab152434 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152434.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up