Overview

  • Product name
    Recombinant Human G6PC3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MESTLGAGIVIAEALQNQLAWLENVWLWITFLGDPKILFLFYFPAAYYAS RRVGIAVLWISLITEWLNLIFKWFLFGDRPFWWVHESGYYSQAPAQVHQF PSSCETGPGSPSGHCMITGAALWPIMTALSSQVATRARSRWVRVMPSLAY CTFLLAVGLSRIFILAHFPHQVLAGLITGAVLGWLMTPRVPMERELSFYG LTALALMLGTSLIYWTLFTLGLDLSWSISLAFKWCERPEWIHVDSRPFAS LSRDSGAALGLGIALHSPCYAQVRRAQLGNGQKIACLVLAMGLLGPLDWL GHPPQISLFYIFNFLKYTLWPCLVLALVPWAVHMFSAQEAPPIHSS
    • Amino acids
      1 to 346
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164911 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • G-6-Pase 3
    • G6Pase 3
    • G6Pase-beta
    • Glucose 6 phosphatase, catalytic, 3
    • Glucose-6-phosphatase 3
    • Glucose-6-phosphatase beta
    • SCN4
    • Ubiquitous glucose-6-phosphatase catalytic subunit-related protein
    • UGRP
    see all
  • Relevance
    G6PC3 is the catalytic subunit of glucose-6-phosphatase (G6Pase). G6Pase is located in the endoplasmic reticulum (ER) and catalyzes the hydrolysis of glucose-6-phosphate to glucose and phosphate in the last step of the gluconeogenic and glycogenolytic pathways. Mutations in this gene result in autosomal recessive severe congenital neutropenia. Multiple transcript variants have been found for this gene, only one of which is expected to express a protein.
  • Cellular localization
    Endoplasmic reticulum membrane; Multi-pass membrane protein.

Images

  • ab164911 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164911 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164911.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up