Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSGGEVVCSGWLRKSPPEKKLKRYAWKRRWFVLRSGRLTGDPDVLEYYKN DHAKKPIRIIDLNLCQQVDAGLTFNKKEFENSYIFDINTIDRIFYLVADS EEEMNKWVRCICDICGFNPTEEDPVKPPGSSLQAPADLPLAINTAPPSTQ ADSSSATLPPPYQLINVPPHLETLGIQEDPQDYLLLINCQSKKPEPTRTH ADSAKSTSSETDCNDNVPSHKNPASSQSKHGMNGFFQQQMIYDSPPSRAP SASVDSSLYNLPRSYSHDVLPKVSPSSTEADGELYVFNTPSGTSSVETQM RHVSISYDIPPTPGNTYQIPRTFPEGTLGQTSKLDTIPDIPPPRPPKPHP AHDRSPVETCSIPRTASDTDSSYCIPTAGMSPSRSNTISTVDLNKLRKDA SSQDCYDIPRAFPSDRSSSLEGFHNHFKVKNVLTVGSVSSEELDENYVPM NPNSPPRQHSSSFTEPIQEANYVPMTPGTFDFSSFGMQVPPPAHMGFRSS PKTPPRRPVPVADCEPPPVDRNLKPDRKGQSPKILRLKPHGLERTDSQTI GDFATRRKVKPAPLEIKPLPEWEELQAPVRSPITRSFARDSSRFPMSPRP DSVHSTTSSSDSHDSEENYVPMNPNLSSEDPNLFGSNSLDGGSSPMIKPK GDKQVEYLDLDLDSGKSTPPRKQKSSGSGSSVADERVDYVVVDQQKTLAL KSTREAWTDGRQSTESETPAKSVK
    • Molecular weight
      106 kDa including tags
    • Amino acids
      1 to 724

Associated products

Specifications

Our Abpromise guarantee covers the use of ab152404 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Gab 1
    • GAB1
    • GAB1_HUMAN
    • GRB 2 associated binder 1
    • GRB 2 associated binding protein 1
    • GRB2 associated binding protein 1 isoform a
    • GRB2 associated binding protein 1 isoform b
    • GRB2-associated binder 1
    • GRB2-associated-binding protein 1
    • Growth factor receptor bound protein 2-associated protein 1
    see all
  • Function
    Probably involved in EGF and insulin receptor signaling.
  • Sequence similarities
    Belongs to the GAB family.
    Contains 1 PH domain.
  • Post-translational
    modifications
    Phosphorylated on tyrosine residue(s) by the epidermal growth factor receptor (EGFR) and the insulin receptor (INSR). Tyrosine phosphorylation of GAB1 mediates interaction with several proteins that contain SH2 domains.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152404 stained with Coomassie Blue.

References

ab152404 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152404.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up