Recombinant Human GABA A Receptor alpha 6 protein (ab152414)

Overview

  • Product name
    Recombinant Human GABA A Receptor alpha 6 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MASSLPWLCIILWLENALGKLEVEGNFYSENVSRILDNLLEGYDNRLRPG FGGAVTEVKTDIYVTSFGPVSDVEMEYTMDVFFRQTWTDERLKFGGPTEI LSLNNLMVSKIWTPDTFFRNGKKSIAHNMTTPNKLFRIMQNGTILYTMRL TINADCPMRLVNFPMDGHACPLKFGSYAYPKSEIIYTWKKGPLYSVEVPE ESSSLLQYDLIGQTVSSETIKSNTGEYVIMTVYFHLQRKMGYFMIQIYTP CIMTVILSQVSFWINKESVPARTVFGITTVLTMTTLSISARHSLPKVSYA TAMDWFIAVCFAFVFSALIEFAAVNYFTNLQTQKAKRKAQFAAPPTVTIS KATEPLEAEIVLHPDSKYHLKKRITSLSLPIVSSSEANKVLTRAPILQST PVTPPPLSPAFGGTSKIDQYSRILFPVAFAGFNLVYWVVYLSKDTMEVSS SVE
    • Molecular weight
      77 kDa including tags
    • Amino acids
      1 to 453

Associated products

Specifications

Our Abpromise guarantee covers the use of ab152414 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • GABA A
    • GABA A receptor alpha 6
    • GABA A Receptor alpha 6 polypeptide
    • GABA A receptor subunit alpha 6
    • GABA subunit A receptor alpha 6
    • GABA(A) receptor subunit alpha-6
    • GABRA 6
    • GABRA6
    • Gamma aminobutyric acid A receptor alpha 6
    • Gamma aminobutyric acid GABA A receptor alpha 6
    • Gamma aminobutyric acid receptor subunit alpha 6
    • Gamma-aminobutyric acid receptor subunit alpha-6
    • GBRA6_HUMAN
    • MGC116903
    • MGC116904
    see all
  • Function
    GABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the GABA/benzodiazepine receptor and opening an integral chloride channel.
  • Sequence similarities
    Belongs to the ligand-gated ion channel (TC 1.A.9) family. Gamma-aminobutyric acid receptor (TC 1.A.9.5) subfamily. GABRA6 sub-subfamily.
  • Cellular localization
    Cell junction > synapse > postsynaptic cell membrane. Cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152414 stained with Coomassie Blue.

References

ab152414 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152414.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up