Recombinant Human GABA A Receptor beta 3 protein (ab114354)

Overview

  • Product nameRecombinant Human GABA A Receptor beta 3 protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP28472
    • SpeciesHuman
    • SequenceQSVNDPGNMSFVKETVDKLLKGYDIRLRPDFGGPPVCVGMNIDIASIDMV SEVNMDYTLTMYFQQYWRDKRLAYSGIPLNLTLDNRVADQLWVPDTYFLN DKKSFVHGVT
    • Molecular weight38 kDa including tags
    • Amino acids26 to 135

Specifications

Our Abpromise guarantee covers the use of ab114354 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ECA5
    • GABA alpha receptor beta-2 subunit
    • GABA(A) receptor subunit beta-3
    • GABAA receptor beta 3 subunit
    • GABAA receptor subunit beta 3
    • GABR B3
    • Gabrb3
    • Gamma aminobutyric acid (GABA) A receptor beta 3
    • Gamma aminobutyric acid receptor subunit beta 3
    • Gamma-aminobutyric acid receptor subunit beta-3
    • GBRB3_HUMAN
    • MGC9051
    see all
  • FunctionComponent of the heteropentameric receptor for GABA, the major inhibitory neurotransmitter in the vertebrate brain. Functions also as histamine receptor and mediates cellular responses to histamine. Functions as receptor for diazepines and various anesthetics, such as pentobarbital; these are bound at a separate allosteric effector binding site. Functions as ligand-gated chloride channel.
  • Involvement in diseaseEpilepsy, childhood absence 5
  • Sequence similaritiesBelongs to the ligand-gated ion channel (TC 1.A.9) family. Gamma-aminobutyric acid receptor (TC 1.A.9.5) subfamily. GABRB3 sub-subfamily.
  • Cellular localizationCell junction, synapse, postsynaptic cell membrane. Cell membrane.
  • Information by UniProt

Recombinant Human GABA A Receptor beta 3 protein images

  • ab114354 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human GABA A Receptor beta 3 protein (ab114354)

ab114354 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114354.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"