Recombinant Human GABA A Receptor gamma 1 protein (ab158485)

Overview

  • Product name
    Recombinant Human GABA A Receptor gamma 1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGPLKAFLFSPFLLRSQSRGVRLVFLLLTLHLGNCVDKADDEDDEDLTVN KTWVLAPKIHEGDITQILNSLLQGYDNKLRPDIGVRPTVIETDVYVNSIG PVDPINMEYTIDIIFAQTWFDSRLKFNSTMKVLMLNSNMVGKIWIPDTFF RNSRKSDAHWITTPNRLLRIWNDGRVLYTLRLTINAECYLQLHNFPMDEH SCPLEFSSYGYPKNEIEYKWKKPSVEVADPKYWRLYQFAFVGLRNSTEIT HTISGDYVIMTIFFDLSRRMGYFTIQTYIPCILTVVLSWVSFWINKDAVP ARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFVSVCFIFVFAALME YGTLHYFTSNQKGKTATKDRKLKNKASMTPGLHPGSTLIPMNNISVPQED DYEYQCLEGKDCASFFCCFEDCRTGSWREGRIHIRIAKIDSYSRIFFPTA FALFNLVYWVGYLYL
    • Amino acids
      1 to 465
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158485 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • GABA(A) receptor subunit gamma 1
    • GabaA/BZ
    • GABRG 1
    • GABRG1
    • Gamma aminobutyric acid (GABA A) receptor subunit gamma 1
    • Gamma aminobutyric acid A receptor, gamma 1
    • GBRG1
    see all
  • Relevance
    GABA A Receptor gamma 1 belongs to the ligand gated ionic channel family. It is an integral membrane protein and plays an important role in inhibiting neurotransmission by binding to the benzodiazepine receptor and opening an integral chloride channel.
  • Cellular localization
    Cell junction, synapse, postsynaptic cell membrane; Multi pass membrane protein.

Images

  • ab158485 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158485 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158485.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up