Recombinant Human GABA B Receptor 1 protein (ab112287)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ9UBS5-2
    • SpeciesHuman
    • SequenceAVYIGALFPMSGGWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDS KCDPGQATKYLYELLYNDPIKIILMPGCSSVSTLVAEAARMWNLIVLSYG
    • Molecular weight37 kDa
    • Amino acids52 to 151
    • TagsGST tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab112287 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione
    Note: Glutathione is reduced

General Info

  • Alternative names
    • dJ271M21.1.1
    • dJ271M21.1.2
    • FLJ92613
    • GABA-B receptor 1
    • GABA-B-R1
    • GABA-BR1
    • GABAB R1
    • GABAB subunit 1c
    • GABABR1
    • GABBR1
    • GABBR1 3
    • GABR1_HUMAN
    • Gamma aminobutyric acid (GABA) B receptor 1
    • Gamma-aminobutyric acid type B receptor subunit 1
    • Gb1
    • GPRC3A
    • Seven transmembrane helix receptor
    see all
  • FunctionReceptor for GABA. The activity of this receptor is mediated by G-proteins that inhibit adenylyl cyclase activity, stimulates phospholipase A2, activates potassium channels, inactivates voltage-dependent calcium-channels and modulates inositol phospholipids hydrolysis. Plays a critical role in the fine-tuning of inhibitory synaptic transmission. Pre-synaptic GABA-B-R inhibit neurotransmitter release by down-regulating high-voltage activated calcium channels, whereas postsynaptic GABA-B-R decrease neuronal excitability by activating a prominent inwardly rectifying potassium (Kir) conductance that underlies the late inhibitory postsynaptic potentials. Not only implicated in synaptic inhibition but also in hippocampal long-term potentiation, slow wave sleep, muscle relaxation and antinociception. Activated by (-)-baclofen, cgp27492 and blocked by phaclofen.
    Isoform 1E function may be to regulate the availability of functional GABA-B-R1A/GABA-B-R2 heterodimers by competing for GABA-B-R2 dimerization. This could explain the observation that certain small molecule ligands exhibit differential affinity for central versus peripheral sites.
  • Tissue specificityHighly expressed in brain and weakly in heart, small intestine and uterus. Isoform 1A is mostly expressed in granular cell and molecular layer. Isoform 1B is mostly expressed in Purkinje cells. Isoform 1E is predominantly expressed in peripheral tissues as kidney, lung, trachea, colon, small intestine, stomach, bone marrow, thymus and mammary gland.
  • Sequence similaritiesBelongs to the G-protein coupled receptor 3 family. GABA-B receptor subfamily.
    Contains 2 Sushi (CCP/SCR) domains.
  • DomainAlpha-helical parts of the C-terminal intracellular region mediate heterodimeric interaction with GABA-B receptor 2. The linker region between the transmembrane domain 3 (TM3) and the transmembrane domain 4 (TM4) probably play a role in the specificity for G-protein coupling.
  • Cellular localizationSecreted and Cell membrane. Cell junction > synapse > postsynaptic cell membrane. Colocalizes with ATF4 in hippocampal neuron dendritic membranes (By similarity). Moreover coexpression of GABA-B-R1 and GABA-B-R2 appears to be a prerequisite for maturation and transport of GABA-B-R1 to the plasma membrane.
  • Information by UniProt

Recombinant Human GABA B Receptor 1 protein images

  • ab112287 analysed on a 12.5% SDS-PAGE stained with Coomassie Blue.

References for Recombinant Human GABA B Receptor 1 protein (ab112287)

ab112287 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112287.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"