Recombinant Human GABA B Receptor 2 protein (ab153000)

Overview

  • Product name
    Recombinant Human GABA B Receptor 2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGLMPLTKEVAKGSIGRGVLPAVELAIEQIRNESLLRPYFLDLRLYDTEC DNAKGLKAFYDAIKYGPNHLMVFGGVCPSVTSIIAESLQGWNLVQLSFAA TTPVLADKKKYPYFFRTVPSDNAVNPAILKLLKHYQWKRVGTLTQDVQRF SEVRNDLTGVLYGEDIEISDTESFSNDPCTSVKKLKGNDVRIILGQFDQN MAAKVFCCAYEENMYGSKYQWIIPGWYEPSWWEQVHTEANSSRCLRKNLL AAMEGYIGVDFEPLSSKQIKTISGKTPQQYEREYNNKRSGVGPSKFHGYA YDGIWVIAKTLQRAMETLHASSRHQRIQDFNYTDHTLGRIILNAMNETNF FGVTGQVVFRNGERMGTIKFTQFQDSREVKVGEYNAVADTLEIINDTIRF QGSEPPKDKTIILEQLRKISLPLYSILSALTILGMIMASAFLFFNIKNRN QKLIKMSSPYMNNLIILGGMLSYASIFLFGLDGSFVSEKTFETLCTVRTW ILTVGYTTAFGAMFAKTWRVHAIFKNVKMKKKIIKDQKLLVIVGGMLLID LCILICWQAVDPLRRTVEKYSMEPDPAGRDISIRPLLEHCENTHMTIWLG IVYAYKGLLMLFGCFLAWETRNVSIPALNDSKYIGMSVYNVGIMCIIGAA VSFLTRDQPNVQFCIVALVIIFCSTITLCLVFVPKLITLRTNPDAATQNR RFQFTQNQKKEDSKTSTSVTSVNQASTSRLEGLQSENHHLRMKITELDKD LEEVTMQLQDTPEKTTYIKQNHYQELNDILNLGNFTESTDGGKAILKNHL DQNPQLQWNTTEPSRTCKDPIEDINSPEHIQRRLSLQLPILHHAYLPSIG GVDASCVSPCVSPTASPRHRHVPPSFRVMVSGL
    • Amino acids
      1 to 883
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153000 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BcDNA:GH07312
    • CG6706
    • CT20836
    • D Gaba2
    • FLJ36928
    • G protein coupled receptor 51
    • G-protein coupled receptor 51
    • GAB B R2
    • GABA B R2
    • GABA B receptor 2
    • GABA-B receptor 2
    • GABA-B-R2
    • GABA-BR2
    • GABAB R2
    • GABABR 2
    • GABABR2
    • GABB R2
    • GABBR 2
    • Gabbr2
    • GABR2_HUMAN
    • Gamma aminobutyric acid B receptor 2
    • Gamma aminobutyric acid GABA B receptor 2
    • Gamma aminobutyric acid type B receptor subunit 2
    • Gamma-aminobutyric acid type B receptor subunit 2
    • Gb 2
    • Gb2
    • GH07312
    • GPR 51
    • GPR51
    • GPRC 3B
    • GPRC3B
    • HG 20
    • HG20
    • HRIHFB2099
    • Metabotropic GABA B receptor subtype 2
    • OTTHUMP00000021776
    • OTTHUMP00000063797
    • R2 SUBUNIT
    see all
  • Function
    Receptor for GABA. The activity of this receptor is mediated by G-proteins that inhibit adenylyl cyclase activity, stimulates phospholipase A2, activates potassium channels, inactivates voltage-dependent calcium-channels and modulates inositol phospholipids hydrolysis. Plays a critical role in the fine-tuning of inhibitory synaptic transmission. Pre-synaptic GABA-B-R inhibit neurotransmitter release by down-regulating high-voltage activated calcium channels, whereas postsynaptic GABA-B-R decrease neuronal excitability by activating a prominent inwardly rectifying potassium (Kir) conductance that underlies the late inhibitory postsynaptic potentials. Not only implicated in synaptic inhibition but also in hippocampal long-term potentiation, slow wave sleep, muscle relaxation and antinociception.
  • Tissue specificity
    Highly expressed in brain, especially in cerebral cortex, thalamus, hippocampus, frontal, occipital and temporal lobe, occipital pole and cerebellum, followed by corpus callosum, caudate nucleus, spinal cord, amygdala and medulla. Weakly expressed in heart, testis and skeletal muscle.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 3 family. GABA-B receptor subfamily.
  • Domain
    Alpha-helical parts of the C-terminal intracellular region mediate heterodimeric interaction with GABA-B receptor 1.
  • Cellular localization
    Cell membrane. Cell junction > synapse > postsynaptic cell membrane. Moreover coexpression of GABA-B-R1 and GABA-B-R2 appears to be a prerequisite for maturation and transport of GABA-B-R1 to the plasma membrane.
  • Information by UniProt

Images

  • ab153000 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153000 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153000.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up