Recombinant Human GABA Transporter 2 protein (ab159525)

Overview

  • Product name
    Recombinant Human GABA Transporter 2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDSRVSGTTSNGETKPVYPVMEKKEEDGTLERGHWNNKMEFVLSVAGEII GLGNVWRFPYLCYKNGGGAFFIPYLVFLFTCGIPVFLLETALGQYTSQGG VTAWRKICPIFEGIGYASQMIVILLNVYYIIVLAWALFYLFSSFTIDLPW GGCYHEWNTEHCMEFQKTNGSLNGTSENATSPVIEFWERRVLKISDGIQH LGALRWELALCLLLAWVICYFCIWKGVKSTGKVVYFTATFPYLMLVVLLI RGVTLPGAAQGIQFYLYPNLTRLWDPQVWMDAGTQIFFSFAICLGCLTAL GSYNKYHNNCYRDCIALCFLNSGTSFVAGFAIFSILGFMSQEQGVPISEV AESGPGLAFIAYPRAVVMLPFSPLWACCFFFMVVLLGLDSQFVCVESLVT ALVDMYPHVFRKKNRREVLILGVSVVSFLVGLIMLTEGGMYVFQLFDYYA ASGMCLLFVAIFESLCVAWVYGAKRFYDNIEDMIGYRPWPLIKYCWLFLT PAVCTATFLFSLIKYTPLTYNKKYTYPWWGDALGWLLALSSMVCIPAWSL YRLGTLKGPFRERIRQLMCPAEDLPQRNPAGPSAPATPRTSLLRLTELES HC
    • Amino acids
      1 to 602
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159525 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • GABA transport protein
    • GAT 2
    • GAT-2
    • GAT2
    • GAT3
    • S6A13_HUMAN
    • SLC6A13
    • Sodium- and chloride-dependent GABA transporter 2
    • Solute carrier family 6 (Neurotransmitter transporter, GABA), member 13
    • Solute carrier family 6 member 13
    see all
  • Function
    Sodium-dependent GABA and taurine transporter. In presynaptic terminals, regulates GABA signaling termination through GABA uptake. May also be involved in beta-alanine transport.
  • Tissue specificity
    Expressed in brain, kidney, lung, liver and testis.
  • Sequence similarities
    Belongs to the sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family. SLC6A13 subfamily.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab159525 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159525 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159525.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up