Recombinant Human GABA Transporter 3 / GAT 3 protein (ab152685)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MTAEKALPLGNGKAAEEARESEAPGGGCSSGGAAPARHPRVKRDKAVHER GHWNNKVEFVLSVAGEIIGLGNVWRFPYLCYKNGGGAFLIPYVVFFICCG IPVFFLETALGQFTSEGGITCWRKVCPLFEGIGYATQVIEAHLNVYYIII LAWAIFYLSNCFTTELPWATCGHEWNTENCVEFQKLNVSNYSHVSLQNAT SPVMEFWE
    • Molecular weight
      49 kDa including tags

Specifications

Our Abpromise guarantee covers the use of ab152685 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • GABT3
    • GAT-3
    • GAT3
    • S6A11_HUMAN
    • Slc6a11
    • Sodium- and chloride-dependent GABA transporter 3
    • Solute carrier family 6 member 11
    see all
  • Function
    Terminates the action of GABA by its high affinity sodium-dependent reuptake into presynaptic terminals.
  • Tissue specificity
    Widespread distribution in the brain.
  • Sequence similarities
    Belongs to the sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family. SLC6A11 subfamily.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152685 stained with Coomassie Blue.

References

ab152685 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152685.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up