Recombinant Human GABARAP protein (ab116475)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionO95166
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMKFVYKEEHPFEKRRSEGEKIRKKYPDRVP VIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFV NNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL
    • Molecular weight16 kDa including tags
    • Amino acids1 to 117
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab116475 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 95 % SDS-PAGE.
    ab116475 is purified by proprietary chromatographic techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.24% Tris, 20% Glycerol, 1.17% Sodium chloride

General Info

  • Alternative names
    • ATG8A
    • FLC 3B
    • FLC3B
    • FLJ25768
    • GABA(A) receptor associated protein
    • GABA(A) receptor-associated protein
    • GABARAP
    • GABARAP a
    • Gamma aminobutyric acid receptor associated protein
    • Gamma-aminobutyric acid receptor-associated protein
    • GBRAP_HUMAN
    • MGC120154
    • MGC120155
    • MM 46
    • MM46
    see all
  • FunctionUbiquitin-like modifier that plays a role in intracellular transport of GABA(A) receptors and its interaction with the cytoskeleton. Involved in apoptosis. Involved in autophagy. Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation.
  • Tissue specificityHeart, brain, placenta, liver, skeletal muscle, kidney and pancreas.
  • Sequence similaritiesBelongs to the ATG8 family.
  • Post-translational
    modifications
    The precursor molecule is cleaved by ATG4B to form the cytosolic form, GABARAP-I. This is activated by APG7L/ATG7, transferred to ATG3 and conjugated to phospholipid to form the membrane-bound form, GABARAP-II.
  • Cellular localizationEndomembrane system. Cytoplasm, cytoskeleton. Golgi apparatus membrane. Cytoplasmic vesicle, autophagosome. Largely associated with intracellular membrane structures including the Golgi apparatus and postsynaptic cisternae. Colocalizes with microtubules (By similarity). Localizes also to discrete punctae along the ciliary axoneme (By similarity).
  • Information by UniProt

References for Recombinant Human GABARAP protein (ab116475)

ab116475 has not yet been referenced specifically in any publications.

Product Wall

Thank you very much for your interest our AbTrial program.

To our knowledge, ab116475 has not been tested in co-IP. However by participating in our AbTrial program you can now use our products in an untested application or species without fina...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"