Recombinant Human GABARAP protein (ab151871)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYL VPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHE EDFFLYIAYSDESVYGL
    • Molecular weight
      14 kDa
    • Amino acids
      1 to 117

Specifications

Our Abpromise guarantee covers the use of ab151871 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. ab151871 was lyophilised from a 0.2 µM filtered solution.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C.

    pH: 7.50
    Constituents: 0.79% Tris HCl, 1.17% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. Dissolve the lyophilised protein in 1X PBS. It is not recommended to reconstitute to a concentration less than 100 µg/ml.
    Reconstituted protein solution can be stored at 4-7°C for 2-7 days. For long term storage aliquot and store at < -20°C.

General Info

  • Alternative names
    • ATG8A
    • FLC 3B
    • FLC3B
    • FLJ25768
    • GABA type A receptor associated protein
    • GABA(A) receptor associated protein
    • GABA(A) receptor-associated protein
    • GABARAP
    • GABARAP a
    • Gamma aminobutyric acid receptor associated protein
    • Gamma-aminobutyric acid receptor-associated protein
    • GBRAP_HUMAN
    • MGC120154
    • MGC120155
    • MM 46
    • MM46
    see all
  • Function
    Ubiquitin-like modifier that plays a role in intracellular transport of GABA(A) receptors and its interaction with the cytoskeleton. Involved in apoptosis. Involved in autophagy. Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation.
  • Tissue specificity
    Heart, brain, placenta, liver, skeletal muscle, kidney and pancreas.
  • Sequence similarities
    Belongs to the ATG8 family.
  • Post-translational
    modifications
    The precursor molecule is cleaved by ATG4B to form the cytosolic form, GABARAP-I. This is activated by APG7L/ATG7, transferred to ATG3 and conjugated to phospholipid to form the membrane-bound form, GABARAP-II.
  • Cellular localization
    Endomembrane system. Cytoplasm, cytoskeleton. Golgi apparatus membrane. Cytoplasmic vesicle, autophagosome. Largely associated with intracellular membrane structures including the Golgi apparatus and postsynaptic cisternae. Colocalizes with microtubules (By similarity). Localizes also to discrete punctae along the ciliary axoneme (By similarity).
  • Information by UniProt

References

ab151871 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151871.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up