Recombinant Human GABARAPL1 protein (ab101641)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9H0R8
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMKFQYKEDHPFEYRKKEGEKIRKKYPDRVP VIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFV NNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK
    • Molecular weight16 kDa including tags
    • Amino acids1 to 117
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101641 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 85 % SDS-PAGE.
    ab101641 was purified using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • APG8 like
    • APG8L
    • ATG8
    • ATG8B
    • ATG8L
    • Early estrogen regulated protein
    • Early estrogen-regulated protein
    • GABA
    • GABA(A) receptor associated protein like 1
    • GABA(A) receptor-associated protein-like 1
    • GABARAPL1
    • GABARAPL1 a
    • Gamma aminobutyric acid receptor associated protein like 1
    • Gamma-aminobutyric acid receptor-associated protein-like 1
    • GBRL1_HUMAN
    • GEC 1
    • GEC-1
    • GEC1
    • Glandular epithelial cell protein 1
    see all
  • FunctionUbiquitin-like modifier that increases cell-surface expression of kappa-type opioid receptor through facilitating anterograde intracellular trafficking of the receptor. Involved in formation of autophagosomal vacuoles. Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation.
  • Tissue specificityUbiquitous. Expressed at very high levels in the brain, heart, peripheral blood leukocytes, liver, kidney, placenta and skeletal muscle. Expressed at very low levels in thymus and small intestine. In the brain, expression is particularly intense in motoneurons in the embryo and in neurons involved in somatomotor and neuroendocrine functions in the adult, particularly in the substantia nigra pars compacta.
  • Sequence similaritiesBelongs to the ATG8 family.
  • Post-translational
    modifications
    The precursor molecule is cleaved by ATG4B to form the cytosolic form, GABARAPL1-I. This is activated by APG7L/ATG7, transferred to ATG3 and conjugated to phospholipid to form the membrane-bound form, GABARAPL1-II (By similarity). ATG4B also mediates the delipidation required for GABARAPL1 recycling when autophagosomes fuse with lysosomes.
    The Legionella effector RavZ is a deconjugating enzyme that produces an ATG8 product that would be resistant to reconjugation by the host machinery due to the cleavage of the reactive C-terminal glycine.
  • Cellular localizationCytoplasm > cytoskeleton. Cytoplasmic vesicle membrane. Endoplasmic reticulum. Golgi apparatus. Cytoplasmic vesicle > autophagosome.
  • Information by UniProt

Recombinant Human GABARAPL1 protein images

  • ab101641 at 3 µg analysed by 15% SDS PAGE.

References for Recombinant Human GABARAPL1 protein (ab101641)

ab101641 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab101641.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"