Recombinant Human GABARAPL2 protein (ab103055)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP60520
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMKWMFKEDHSLEHRCVESAKIRAKYPDRVP VIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFV DKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF
    • Molecular weight16 kDa including tags
    • Amino acids1 to 117
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab103055 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab103055 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 20% Glycerol, 0.2M Sodium chloride, 5mM DTT, 20mM Tris HCl, pH 8.0

General Info

  • Alternative names
    • ATG8
    • ATG8C
    • FLC3A
    • GABA(A) receptor-associated protein-like 2
    • Gabarapl2
    • Gamma-aminobutyric acid receptor-associated protein-like 2
    • Ganglioside expression factor 2
    • GATE-16
    • GATE16
    • GBRL2_HUMAN
    • GEF-2
    • GEF2
    • General protein transport factor p16
    • Golgi-associated ATPase enhancer of 16 kDa
    • MAP1 light chain 3-related protein
    see all
  • FunctionInvolved in intra-Golgi traffic. Modulates intra-Golgi transport through coupling between NSF activity and SNAREs activation. It first stimulates the ATPase activity of NSF which in turn stimulates the association with GOSR1.
  • Tissue specificityUbiquitous. Expressed at high levels in the brain, heart, prostate, ovary, spleen and skeletal muscle. Expressed at very low levels in lung, thymus and small intestine.
  • Sequence similaritiesBelongs to the MAP1 LC3 family.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localizationGolgi apparatus.
  • Information by UniProt

Recombinant Human GABARAPL2 protein images

  • 15% SDS-PAGE (3 µg)

References for Recombinant Human GABARAPL2 protein (ab103055)

ab103055 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab103055.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"