Recombinant Human GABARAPL2 protein (ab103055)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMKWMFKEDHSLEHRCVESAKIRAKYPDRVP VIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFV DKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF
    • Molecular weight
      16 kDa including tags
    • Amino acids
      1 to 117
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab103055 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab103055 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 20% Glycerol, 0.2M Sodium chloride, 5mM DTT, 20mM Tris HCl, pH 8.0

General Info

  • Alternative names
    • ATG8
    • ATG8C
    • FLC3A
    • GABA(A) receptor-associated protein-like 2
    • Gabarapl2
    • Gamma-aminobutyric acid receptor-associated protein-like 2
    • Ganglioside expression factor 2
    • GATE-16
    • GATE16
    • GBRL2_HUMAN
    • GEF-2
    • GEF2
    • General protein transport factor p16
    • Golgi-associated ATPase enhancer of 16 kDa
    • MAP1 light chain 3-related protein
    see all
  • Function
    Involved in intra-Golgi traffic. Modulates intra-Golgi transport through coupling between NSF activity and SNAREs activation. It first stimulates the ATPase activity of NSF which in turn stimulates the association with GOSR1.
  • Tissue specificity
    Ubiquitous. Expressed at high levels in the brain, heart, prostate, ovary, spleen and skeletal muscle. Expressed at very low levels in lung, thymus and small intestine.
  • Sequence similarities
    Belongs to the MAP1 LC3 family.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Golgi apparatus.
  • Information by UniProt

Images

  • 15% SDS-PAGE (3 µg)

References

ab103055 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab103055.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up