Recombinant Human GABPB2 protein (ab165259)

Overview

  • Product name
    Recombinant Human GABPB2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSLVDLGKRLLEAARKGQDDEVRTLMANGAPFTTDWLGTSPLHLAAQYGH YSTAEVLLRAGVSRDARTKVDRTPLHMAAADGHAHIVELLVRNGADVNAK DMLKMTALHWATERHHRDVVELLIKYGADVHAFSKFDKSAFDIALEKNNA EILVILQEAMQNQVNVNPERANPVTDPVSMAAPFIFTSGEVVNLASLISS TNTKTTSGDPHASTVQFSNSTTSVLATLAALAEASVPLSNSHRATANTEE IIEGNSVDSSIQQVMGSGGQRVITIVTDGVPLGNIQTSIPTGGIGQPFIV TVQDGQQVLTVPAGKVAEETVIKEEEEEKLPLTKKPRIGEKTNSVEESKE GNERELLQQQLQEANRRAQEYRHQLLKKEQEAEQYRLKLEAIARQQPNGV DFTMVEEVAEVDAVVVTEGELEERETKVTGSAGTTEPHTRVSMATVSS
    • Amino acids
      1 to 448
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165259 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BABPB2
    • E4TF1
    • E4TF1 47
    • E4TF1 53
    • E4TF1B
    • GA binding protein beta chain
    • GA binding protein transcription factor beta subunit 2
    • GA-binding protein subunit beta-2
    • GABP 2
    • GABP subunit beta 1
    • GABP subunit beta 2
    • GABP subunit beta-2
    • GABP2_HUMAN
    • GABPB 1
    • GABPB-2
    • GABPB1
    • Gabpb2
    • NRF2B1
    • NRF2B2
    • Nuclear respiratory factor 2
    • Nuclear respiratory factor 2 subunit beta
    • RP11-68I18.1
    • Transcription factor E4TF1 47
    • Transcription factor E4TF1 53
    see all
  • Function
    May function as transcription factor capable of interacting with purine rich repeats (GA repeats).
  • Sequence similarities
    Contains 5 ANK repeats.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab165259 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165259 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165259.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up