Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ05329
    • SpeciesHuman
    • SequenceMASPGSGFWSFGSEDGSGDSENPGTARAWCQVAQKFTGGIGNKLCALLYG DAEKPAESGGSQPPRAAARKAACAC DQKPCSCSKVDVNYAFLHATDLL PACDGERPTLAFLQDVMNILLQYVVKSFDRSTKVIDFHYPNELLQEYNWE LA DQPQNLEEILMHCQTTLKYAIKTGHPRYFNQLSTGLDMVGLAADWL TSTANTNMFTYEIAPVFVLLEYVTLKKMR EIIGWPGGSGDGIFSPGGA ISNMYAMMIARFKMFPEVKEKGMAALPRLIAFTSEHSHFSLKKGAAALGI GTDSVI LIKCDERGKMIPSDLERRILEAKQKGFVPFLVSATAGTTVYG AFDPLLAVADICKKYKIWMHVDAAWGGGLLMSR KHKWKLSGVERANSV TWNPHKMMGVPLQCSALLVREEGLMQNCNQMHASYLFQQDKHYDLSYDTG DKALQCGRHV DVFKLWLMWRAKGTTGFEAHVDKCLELAEYLYNIIKNR EGYEMVFDGKPQHTNVCFWYIPPSLRTLEDNEERMSR LSKVAPVIKAR MMEYGTTMVSYQPLGDKVNFFRMVISNPAATHQDIDFLIEEIERLGQDL
    • Molecular weight90 kDa including tags
    • Amino acids1 to 585

Specifications

Our Abpromise guarantee covers the use of ab114208 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 65 kDa glutamic acid decarboxylase
    • DCE 2
    • DCE2
    • DCE2_HUMAN
    • GAD 2
    • GAD 65
    • GAD-2
    • GAD-65
    • Gad2
    • Glutamate decarboxylase 2
    • Glutamate decarboxylase 2 (pancreas)
    • Glutamate Decarboxylase 2 (pancreatic islets and brain 65kDa)
    • Glutamate Decarboxylase 65
    • Glutamate decarboxylase 65 kDa isoform
    • Glutamic Acid Decarboxylase 2
    • Glutamic Acid Decarboxylase 65
    • MGC161605
    • MGC161607
    see all
  • FunctionCatalyzes the production of GABA.
  • Sequence similaritiesBelongs to the group II decarboxylase family.
  • Post-translational
    modifications
    Phosphorylated; which does not affect kinetic parameters or subcellular location.
    Palmitoylated; which is required for presynaptic clustering.
  • Cellular localizationCytoplasm > cytosol. Cytoplasmic vesicle. Cell junction > synapse > presynaptic cell membrane. Golgi apparatus membrane. Associated to cytoplasmic vesicles. In neurons, cytosolic leaflet of Golgi membranes and presynaptic clusters.
  • Information by UniProt

Recombinant Human GAD65 protein images

  • 12.5% SDS-PAGE analysis of ab114208 stained with Coomassie Blue.

References for Recombinant Human GAD65 protein (ab114208)

This product has been referenced in:

See 1 Publication for this product

Product Wall

There are currently no Abreviews or Questions for ab114208.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"