Recombinant Human GAD67 protein (ab114255)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MASSTPSSSATSSNAGADPNTTNLRPTTYDTWCGVAHGCTRKLGLKICGF LQRTNSLEEKSRLVSAFKERQSSKNLLSCENSDRDARFRRTETDFSNLFA RDLLPAKNGEEQTVQFLLEVVDILLNYVRKTFDRSTKVLDFHHPHQLLEG MEGFNLELSDHPESLEQILVDCRDTLKYGVRTGHPRFFNQLSTGLDIIGL AGEWLTSTANTNMFTYEIAPVFVLMEQITLKKMREIVGWSSKDGDGIFSP GGAISNMYSIMAARYKYFPEVKTKGMAAVPKLVLFTSEQSHYSIKKAGAA LGFGTDNVILIKCNERGKIIPADFEAKILEAKQKGYVPFYVNATAGTTVY GAFDPIQEIADICEKYNLWLHVDAAWGGGLLMSRKHRHKLNGIERANSVT WNPHKMMGVLLQCSAILVKEKGILQGCNQMCAGYLFQPDKQYDVSYDTGD KAIQCGRHVDIFKFWLMWKAKGTVGFENQINKCLELAEYLYAKIKNREEF EMVFNGEPEHTNVCFWYIPQSLRGVPDSPQRREKLHKVAPKIKALMMESG TTMVGYQPQGDKANFFRMVISNPAATQSDIDFLIEEIERLGQDL
    • Molecular weight
      91 kDa including tags
    • Amino acids
      1 to 594

Specifications

Our Abpromise guarantee covers the use of ab114255 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 67 kDa glutamic acid decarboxylase
    • CPSQ1
    • DCE1
    • DCE1_HUMAN
    • EC 4.1.1.15
    • FLJ45882
    • GAD
    • GAD 67
    • GAD-67
    • GAD1
    • Glutamate decarboxylase 1
    • Glutamate decarboxylase 1 (brain, 67kDa)
    • Glutamate decarboxylase 1 brain 67kD
    • Glutamate decarboxylase 1 brain 67kDa
    • Glutamate decarboxylase 67 kDa isoform
    • Glutamate decarboxylase, brain, 67-KD
    • OTTHUMP00000041055
    • SCP
    see all
  • Function
    Catalyzes the production of GABA.
  • Tissue specificity
    Isoform 3 is expressed in pancreatic islets, testis, adrenal cortex, and perhaps other endocrine tissues, but not in brain.
  • Involvement in disease
    Defects in GAD1 are the cause of cerebral palsy spastic quadriplegic type 1 (CPSQ1) [MIM:603513]. A non-progressive disorder of movement and/or posture resulting from defects in the developing central nervous system. Affected individuals manifest symmetrical, non-progressive spasticity and no adverse perinatal history or obvious underlying alternative diagnosis. Developmental delay, mental retardation and sometimes epilepsy can be part of the clinical picture.
  • Sequence similarities
    Belongs to the group II decarboxylase family.
  • Information by UniProt

Images

  • ab114255 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References

ab114255 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Thank you for your inquiry.

The Tissue Specificity section on our datasheets is pulled from the Swiss Prot entry for the protein and is just general information about the protein, not specific for the products themselves.

http://www...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up