Recombinant Human GAD67 protein (ab114256)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ99259
    • SpeciesHuman
    • SequenceMASSTPSSSATSSNAGADPNTTNLRPTTYDTWCGVAHGCTRKLGLKICGF LQRTNSLEEKSRLVSAFKERQSSKNLLSCENSDRDARFRRTETDFSNLFA RDLLPAKNGEEQTVQFLLEVVDILLNYVRKTFDRSTKVLDFHHPHQLLEG MEGFNLELSDHPESLEQILVDCRDTLKYGVRTGHPRFFNQLSTGLDIIGL AGEWLTSTANTNMFTYEIAPVFVLMEQITLKKMREIVGWSSKDGDGIFSP GGAISNMYSIMAARYKYFPEVKTKGMAAVPKLVLFTSEQSRYSIKKAGAA LGFGTDNVILIKCNERGEIIPADFEAKILEAKQKGYVPFYVNATAGTTVY GAFDPIQEIADICEKYNLWLHVDAAWGGGLLMSRKHRHKLNGIERANSVT WNPHKMMGVLLQCSAILVKEKGILQGCNQMCAGYLFQPDKQYDVSYDTGD KAIQCGRHVDIFKFWLMWKAKGTVGFENQINKCLELAEYLYAKIKNREEF EMVFNGEPEHTNVCFWYIPQSLRGVPDSPQRREKLHKVAPKIKALMMESG TTMVGYQPQGDKANFFRMVISNPAATQSDIDFLIEEIERLGQDL
    • Molecular weight91 kDa including tags
    • Amino acids1 to 594

Specifications

Our Abpromise guarantee covers the use of ab114256 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 µg/µl
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 67 kDa glutamic acid decarboxylase
    • CPSQ1
    • DCE1
    • DCE1_HUMAN
    • EC 4.1.1.15
    • FLJ45882
    • GAD
    • GAD 67
    • GAD-67
    • GAD1
    • Glutamate decarboxylase 1
    • Glutamate decarboxylase 1 (brain, 67kDa)
    • Glutamate decarboxylase 1 brain 67kD
    • Glutamate decarboxylase 1 brain 67kDa
    • Glutamate decarboxylase 67 kDa isoform
    • Glutamate decarboxylase, brain, 67-KD
    • OTTHUMP00000041055
    • SCP
    see all
  • FunctionCatalyzes the production of GABA.
  • Tissue specificityIsoform 3 is expressed in pancreatic islets, testis, adrenal cortex, and perhaps other endocrine tissues, but not in brain.
  • Involvement in diseaseDefects in GAD1 are the cause of cerebral palsy spastic quadriplegic type 1 (CPSQ1) [MIM:603513]. A non-progressive disorder of movement and/or posture resulting from defects in the developing central nervous system. Affected individuals manifest symmetrical, non-progressive spasticity and no adverse perinatal history or obvious underlying alternative diagnosis. Developmental delay, mental retardation and sometimes epilepsy can be part of the clinical picture.
  • Sequence similaritiesBelongs to the group II decarboxylase family.
  • Information by UniProt

Recombinant Human GAD67 protein images

  • ab114256 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References for Recombinant Human GAD67 protein (ab114256)

ab114256 has not yet been referenced specifically in any publications.

Product Wall

Thank you for your inquiry.

The Tissue Specificity section on our datasheets is pulled from the Swiss Prot entry for the protein and is just general information about the protein, not specific for the products themselves.

http://www...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"