Recombinant Human GADD45A protein (BSA and azide free) (ab172160)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMTLEEFSAGEQKTERMDKVGDALEEVLSKA LSQRTITVGVYEAAKLNVDPDNVVLCLLAADEDDDRDVALQIHFTLIQAF CCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPH SSQWKDPALSQLICFCRESRYMDQWVPVINLPER
    • Molecular weight
      18 kDa
    • Amino acids
      1 to 165
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab172160 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle.

    pH: 7.2
    Constituent: 100% PBS

General Info

  • Alternative names
    • DDIT 1
    • DDIT-1
    • DDIT1
    • DNA damage inducible transcript 1
    • DNA damage-inducible transcript 1 protein
    • GA45A_HUMAN
    • GADD45
    • GADD45A
    • Growth arrest and DNA damage inducible 45 alpha
    • Growth arrest and DNA damage inducible alpha
    • Growth arrest and DNA damage-inducible protein GADD45 alpha
    see all
  • Function
    Binds to proliferating cell nuclear antigen. Might affect PCNA interaction with some CDK (cell division protein kinase) complexes; stimulates DNA excision repair in vitro and inhibits entry of cells into S phase.
  • Sequence similarities
    Belongs to the GADD45 family.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab172160.

     

    Lane 1: Non-reduced

    Lane 2: Reduced

References

ab172160 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172160.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up