Recombinant Human GADD45GIP1 protein (ab113863)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMPRWQLGPRYAAKQFARYGAASGVVPGSLW PSPEQLRELEAEEREWYPSLATMQESLRVKQLAEEQKRREREQHIAECMA KMPQMIVNWQQQQRENWEKAQADKERRARLQAEAQELLGYQVDPRSARFQ ELLQDLEKKERKRLKEEKQKRKKEARAAALAAAVAQDPAASGAPSS
    • Molecular weight
      23 kDa including tags
    • Amino acids
      48 to 222
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113863 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab113863 was purified by using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 40% Glycerol, 0.03% DTT, 1.17% Sodium chloride

General Info

  • Alternative names
    • 39S ribosomal protein L59 mitochondrial
    • CKBBP2
    • CKbetaBP2
    • CKII beta associating protein
    • CKII beta binding protein 2
    • CKII beta-associating protein
    • CR6 interacting factor 1
    • CR6-interacting factor 1
    • CRIF1
    • G45IP_HUMAN
    • Gadd45gip1
    • Growth arrest and DNA damage inducible GADD45G interacting protein
    • growth arrest and DNA damage inducible, gamma interacting protein 1
    • Growth arrest and DNA damage-inducible proteins-interacting protein 1
    • MGC4667
    • MGC4758
    • MRP L59
    • p53 responsive gene 6
    • p53 responsive gene 6 protein
    • p53-responsive gene 6 protein
    • Papillomavirus L2 interacting nuclear protein 1
    • Papillomavirus L2-interacting nuclear protein 1
    • PLINP
    • PLINP 1
    • PLINP-1
    • PLINP1
    • PRG6
    see all
  • Function
    Acts as a negative regulator of G1 to S cell cycle phase progression by inhibiting cyclin-dependent kinases. Inhibitory effects are additive with GADD45 proteins but occurs also in the absence of GADD45 proteins. Acts as a repressor of the orphan nuclear receptor NR4A1 by inhibiting AB domain-mediated transcriptional activity. May be involved in the hormone-mediated regulation of NR4A1 transcriptional activity.
  • Tissue specificity
    Widely expressed. Highly expressed in the thyroid gland, heart, lymph nodes, trachea and adrenal tissues. Expressed at lower level in liver skeletal muscle, kidney, pancreas, testis, ovary and stomach. Barely detectable in adrenal adenoma and papillary thyroid cancer.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Recombinant Human GADD45GIP1 protein images

  • ab113863 at 3 µg analysed by 15% SDS-PAGE.

References for Recombinant Human GADD45GIP1 protein (ab113863)

ab113863 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113863.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up