Overview

  • Product nameRecombinant Human GAGE1 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ13065
    • SpeciesHuman
    • SequenceMSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQR QDPAAAQEGEDEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPP NPEEVKTPEEEMRSHYVAQTGILWLLMNNCFLNLSPRKP
    • Molecular weight41 kDa including tags
    • Amino acids1 to 138

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114932 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • Cancer/testis antigen 4.1
    • CT4 1
    • G antigen 1
    • GAGE 1
    • MZ2 F antigen
    see all
  • RelevanceThe GAGE1 gene belongs to a family of genes that are expressed in a variety of tumors but not in normal tissues, except for the testis. The sequences of the family members are highly related but differ by scattered nucleotide substitutions. The GAGE1 cDNA contains a 143-bp insertion, located in the coding sequence near the termination codon, that is absent from the other cDNAs. Autologous cytolytic T lymphocytes recognise the antigenic peptide YRPRPRRY, which is also encoded by several other family members. Nothing is presently known about the function of this protein. An alternatively spliced transcript variant has been found for this gene.

Recombinant Human GAGE1 protein images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab114932 at approximately 41.36kDa.

References for Recombinant Human GAGE1 protein (ab114932)

ab114932 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114932.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"