Overview

  • Product name
    Recombinant Human GAJ protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSKKKGLSAEEKRTRMMEIFSETKDVFQLKDLEKIAPKEKGITAMSVKEV LQSLVDDGMVDCERIGTSNYYWAFPSKALHARKHKLEVLESQLSEGSQKH ASLQKSIEKAKIGRCETEERTRLAKELSSLRDQREQLKAEVEKYKDCDPQ VVEEIRQANKVAKEAANRWTDNIFAIKSWAKRKFGFEENKIDRTFGIPED FDYID
    • Amino acids
      1 to 205
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164483 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2610034E18Rik
    • AI591601
    • GAJ protein
    • Homolog of yeast MND1
    • Meiotic nuclear division 1, S. cerevisiae. homolog of
    • Meiotic nuclear division protein 1 homolog
    • Meiotic nuclear divisions 1 homolog
    • Meiotic nuclear divisions 1 homolog (S. cerevisiae)
    • MGC134110
    • MND1
    • RGD1309007
    see all
  • Relevance
    The product of the GAJ gene associates with HOP2 to form a stable heterodimeric complex that binds DNA and stimulates the recombinase activity of RAD51 and DMC1 (Chi et al., 2007 [PubMed 17639080]). Both the MND1 and HOP2 genes are indispensable for meiotic recombination.
  • Cellular localization
    Nuclear

Images

  • ab164483 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164483 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164483.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up