Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionO14976
    • SpeciesHuman
    • SequenceSAVAPTPATEGPLFSPGGQPAPCGSQASWTKSQNPDPFADLGDLSSGLQG SPAGFPPGGFIPKTATTPKGSSSWQTSRPPAQGASWPPQAKPPPKACTQP
    • Molecular weight37 kDa including tags
    • Amino acids151 to 250

Specifications

Our Abpromise guarantee covers the use of ab114800 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Auxilin 2
    • Cyclin G associated kinase
    • Cyclin-G-associated kinase
    • DNAJ26
    • DNAJC26
    • EC 2.7.11.1
    • FLJ16629
    • FLJ40395
    • GAK
    • GAK protein
    • GAK_HUMAN
    • MGC99654
    see all
  • FunctionAssociates with cyclin G and CDK5. Seems to act as an auxilin homolog that is involved in the uncoating of clathrin-coated vesicles by Hsc70 in non-neuronal cells. Expression oscillates slightly during the cell cycle, peaking at G1.
  • Tissue specificityUbiquitous. Highest in testis.
  • Sequence similaritiesBelongs to the protein kinase superfamily. Ser/Thr protein kinase family.
    Contains 1 C2 tensin-type domain.
    Contains 1 J domain.
    Contains 1 phosphatase tensin-type domain.
    Contains 1 protein kinase domain.
  • Cellular localizationCytoplasm > perinuclear region. Golgi apparatus > trans-Golgi network. Cell junction > focal adhesion. Localizes to the perinuclear area and to the trans-Golgi network. Also seen on the plasma membrane, probably at focals adhesions.
  • Information by UniProt

Recombinant Human GAK protein images

  • ab114800 on 12.5% SDS-PAGE Stained with Coomassie Blue.

References for Recombinant Human GAK protein (ab114800)

ab114800 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114800.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"