Recombinant Human Galactoside 2-alpha-L-fucosyltransferase 1 protein (ab158476)

Overview

  • Product name
    Recombinant Human Galactoside 2-alpha-L-fucosyltransferase 1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MWLRSHRQLCLAFLLVCVLSVIFFLHIHQDSFPHGLGLSILCPDRRLVTP PVAIFCLPGTAMGPNASSSCPQHPASLSGTWTVYPNGRFGNQMGQYATLL ALAQLNGRRAFILPAMHAALAPVFRITLPVLAPEVDSRTPWRELQLHDWM SEEYADLRDPFLKLSGFPCSWTFFHHLREQIRREFTLHDHLREEAQSVLG QLRLGRTGDRPRTFVGVHVRRGDYLQVMPQRWKGVVGDSAYLRQAMDWFR ARHEAPVFVVTSNGMEWCKENIDTSQGDVTFAGDGQEATPWKDFALLTQC NHTIMTIGTFGFWAAYLAGGDTVYLANFTLPDSEFLKIFKPEAAFLPEWV GINADLSPLWTLAKP
    • Amino acids
      1 to 365
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158476 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2)FT 1
    • 2-alpha-L-fucosyltransferase
    • Alpha (1 2) fucosyltransferase
    • Alpha(1
    • Alpha(1 2)FT 1
    • Blood group H alpha 2-fucosyltransferase
    • Fucosyltransferase 1
    • fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase)
    • FUT1
    • FUT1_HUMAN
    • Galactoside 2 alpha L fucosyltransferase
    • Galactoside 2-alpha-L-fucosyltransferase 1
    • GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 1
    • H
    • HH
    • HSC
    • Para Bombay phenotype
    see all
  • Function
    Creates a soluble precursor oligosaccharide FuC-alpha ((1,2)Galbeta-) called the H antigen which is an essential substrate for the final step in the soluble A and B antigen synthesis pathway. H and Se enzymes fucosylate the same acceptor substrates but exhibit different Km values.
  • Pathway
    Protein modification; protein glycosylation.
  • Sequence similarities
    Belongs to the glycosyltransferase 11 family.
  • Cellular localization
    Golgi apparatus > Golgi stack membrane. Membrane-bound form in trans cisternae of Golgi.
  • Information by UniProt

Images

  • ab158476 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158476 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158476.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up