Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMAEKVLVTGGAGYIGSHTVLELLEAGYLPV VIDNFHNAFRGGGSLPESLRRVQELTGRSVEFEEMDILDQGALQRLFKKY SFMAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFS SSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNA VLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDY DTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQM VQAMEKASGKKIPYKVVARREGDVAACYANPSLAQEELGWTAALGLDRMC EDLWRWQKQNPSGFGTQA
    • Molecular weight
      40 kDa including tags
    • Amino acids
      1 to 348
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab96767 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Purity
    > 95 % SDS-PAGE.
    ab96767 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 5mM DTT, 20mM Tris HCl, 1mM EDTA, pH 8.0

General Info

  • Alternative names
    • FLJ95174
    • FLJ97302
    • Galactose 4 epimerase UDP
    • Galactowaldenase
    • galE
    • GALE_HUMAN
    • OTTHUMP00000002991
    • OTTHUMP00000002994
    • OTTHUMP00000037931
    • OTTHUMP00000044857
    • SDR1E1
    • short chain dehydrogenase/reductase family 1E member 1
    • UDP galactose 4 epimerase
    • UDP galactose 4' epimerase
    • UDP glucose 4 epimerase
    • UDP-galactose 4-epimerase
    • UDP-glucose 4-epimerase
    see all
  • Function
    Catalyzes two distinct but analogous reactions: the epimerization of UDP-glucose to UDP-galactose and the epimerization of UDP-N-acetylglucosamine to UDP-N-acetylgalactosamine.
  • Pathway
    Carbohydrate metabolism; galactose metabolism.
  • Involvement in disease
    Defects in GALE are the cause of epimerase-deficiency galactosemia (EDG) [MIM:230350]; also known as galactosemia type 3. Clinical features include early-onset cataracts, liver damage, deafness and mental retardation. There are two clinically distinct forms of EDG. (1) A benign, or 'peripheral' form with no detectable GALE activity in red blood cells and characterized by mild symptoms. Some patients may suffer no symptoms beyond raised levels of galactose-1-phosphate in the blood. (2) A much rarer 'generalized' form with undetectable levels of GALE activity in all tissues and resulting in severe features such as restricted growth and mental development.
  • Sequence similarities
    Belongs to the sugar epimerase family.
  • Information by UniProt

Recombinant Human GALE protein images

  • 15% SDS-PAGE showing ab96767 at approximately 40.4kDa (3µg).

References for Recombinant Human GALE protein (ab96767)

ab96767 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab96767.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up