Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMAEKVLVTGGAGYIGSHTVLELLEAGYLPV VIDNFHNAFRGGGSLPESLRRVQELTGRSVEFEEMDILDQGALQRLFKKY SFMAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFS SSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNA VLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDY DTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQM VQAMEKASGKKIPYKVVARREGDVAACYANPSLAQEELGWTAALGLDRMC EDLWRWQKQNPSGFGTQA
    • Molecular weight
      40 kDa including tags
    • Amino acids
      1 to 348
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab96767 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Purity
    > 95 % SDS-PAGE.
    ab96767 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 5mM DTT, 20mM Tris HCl, 1mM EDTA, pH 8.0

General Info

  • Alternative names
    • FLJ95174
    • FLJ97302
    • Galactose 4 epimerase UDP
    • Galactowaldenase
    • galE
    • GALE_HUMAN
    • OTTHUMP00000002991
    • OTTHUMP00000002994
    • OTTHUMP00000037931
    • OTTHUMP00000044857
    • SDR1E1
    • short chain dehydrogenase/reductase family 1E member 1
    • UDP galactose 4 epimerase
    • UDP galactose 4' epimerase
    • UDP glucose 4 epimerase
    • UDP-galactose 4-epimerase
    • UDP-glucose 4-epimerase
    see all
  • Function
    Catalyzes two distinct but analogous reactions: the epimerization of UDP-glucose to UDP-galactose and the epimerization of UDP-N-acetylglucosamine to UDP-N-acetylgalactosamine.
  • Pathway
    Carbohydrate metabolism; galactose metabolism.
  • Involvement in disease
    Defects in GALE are the cause of epimerase-deficiency galactosemia (EDG) [MIM:230350]; also known as galactosemia type 3. Clinical features include early-onset cataracts, liver damage, deafness and mental retardation. There are two clinically distinct forms of EDG. (1) A benign, or 'peripheral' form with no detectable GALE activity in red blood cells and characterized by mild symptoms. Some patients may suffer no symptoms beyond raised levels of galactose-1-phosphate in the blood. (2) A much rarer 'generalized' form with undetectable levels of GALE activity in all tissues and resulting in severe features such as restricted growth and mental development.
  • Sequence similarities
    Belongs to the sugar epimerase family.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab96767 at approximately 40.4kDa (3µg).

References

ab96767 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab96767.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up