Recombinant Human Galectin 10 protein (ab107951)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionC5HZ13
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMSLLPVPYTEAASLSTGSTVTIKGRPLACF LNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKN MPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDI SLTKFNVSYLKR
    • Molecular weight19 kDa including tags
    • Amino acids1 to 162
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab107951 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    Purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • BSF3
    • Charcot Leyden crystal protein
    • Charcot-Leyden crystal protein
    • CLC
    • EC 3.1.1.5
    • Eosinophil lysophospholipase
    • Gal-10
    • Galectin-10
    • LGALS10
    • LGALS10A
    • LPPL HUMAN
    • LPPL_HUMAN
    • Lysolecithin acylhydrolase
    • MGC149659
    see all
  • FunctionMay have both lysophospholipase and carbohydrate-binding activities.
  • Tissue specificityExpressed exclusively by eosinophils and basophils. Not detected in monocytes and neutrophils.
  • Sequence similaritiesContains 1 galectin domain.
  • Cellular localizationCytoplasmic granule. Localized in granules from where it may be secreted or transported to other locations in the cell.
  • Information by UniProt

Recombinant Human Galectin 10 protein images

  • 15% SDS-PAGE analysis of ab107951 (3 µg).

References for Recombinant Human Galectin 10 protein (ab107951)

ab107951 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab107951.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"