Recombinant Human Galectin 13 protein (ab174452)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMSSLPVPYKLPVSLSVGSCVIIKGTPI HSFINDPQLQVDFYTDMDEDSDIAFRFRVHFGNHVVMNRREFGIWMLEET TDYVPFEDGKQFELCIYVHYNEYEIKVNGIRIYGFVHRIPPSFVKMVQVS RDISLTSVCVCN
    • Molecular weight
      19 kDa including tags
    • Amino acids
      1 to 139
    • Tags
      His tag N-Terminus
    • Additional sequence information
      NCBI Accession No.: NP_037400

Specifications

Our Abpromise guarantee covers the use of ab174452 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    >95% by SDS-PAGE .
    ab174452 is purified by using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

General Info

  • Alternative names
    • GAL 13
    • Gal-13
    • GAL13
    • Galactoside binding soluble lectin 13
    • Galactoside-binding soluble lectin 13
    • Galectin-13
    • Galectin13
    • Lectin galactoside binding soluble 13
    • LGALS 13
    • LGALS13
    • PLAC 8
    • PLAC8
    • Placental protein 13
    • Placental tissue protein 13
    • PP13
    • PP13_HUMAN
    see all
  • Function
    Has lysophospholipase activity.
  • Tissue specificity
    Detected in adult and fetal spleen, fetal kidney, adult urinary bladder and placenta.
  • Sequence similarities
    Contains 1 galectin domain.
  • Information by UniProt

Images

  • 15% SDS-PAGE using ab174452 at 3µg.

References

ab174452 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174452.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up